KEGG   Equus caballus (horse): 100053396Help
Entry
100053396         CDS       T01058                                 

Gene name
GPX1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100053396 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100053396 (GPX1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100053396 (GPX1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100053396 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 201 aa AA seqDB search
MCAAQLAAAARRSVYAFSARPLAGGEPLSLGSLRGKVLLIENVASLUGTTVRDYTQMNEL
QRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGAQA
HPLFAFLREALPAPSDDATALMTDPKFITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRR
FPTIDIEPDIEALLTQGPSCA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctgctcagcttgcggctgccgcccggcgctcggtgtacgccttctctgcgcgc
ccgctggccggcggggagcccttgagcctgggctccctgcgtggcaaggtgctgctcatt
gagaatgtagcgtcgctctgaggcacaacggtccgggactacacccagatgaacgagctg
cagcggcgccttgggccccgcggcctggtcgtgctcggcttcccgtgcaaccagttcggg
catcaggagaacgccaagaacgaagagatcctgaattccctcaagtacgtccgacctggc
ggcgggttcgagcccaacttcacactctttgagaagtgcgaggtgaatggtgcgcaggcg
cacccgctcttcgccttcctgcgggaggctctgcctgcccccagtgacgacgccactgcg
ctcatgaccgaccctaagttcatcacctggtctccagtgtgccgcaacgatgtcgcctgg
aacttcgagaagtttctggtgggcccggacggtgtgcctgtgcgcaggtacagccgccgc
tttccaaccatcgatattgagcccgacatcgaagccctgctgacccaggggcccagctgt
gcctag

DBGET integrated database retrieval system