KEGG   Equus caballus (horse): 100053443Help
Entry
100053443         CDS       T01058                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin specific peptidase 4 (proto-oncogene)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100053443 (USP4)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100053443 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 963 aa AA seqDB search
MAEGGGCCERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTVPSRN
FTTSPKSSASPYSSVSASPIANGDSTNTSGMRSSGVSRGGSGFSASYNCQESPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPRCRPTQYRVIVPLMGAVSDLCEALSRLSGIAAENMVVTDVYN
HRFHKIFQMDEGLNHIMPRDDIFVYETCSTSSDSSECVTLPVYFRERKSRTSSTSSGAVL
YGQPLLISVPRHKLTFESLYEAVCERISRYIKQPLPDESGGLPLEPGACNGSRGSCEGDD
EEEMEHQEEGKEHLSETEGSGEDELGSEHSETTQKIKGQPCPKRLFTFSLVNSYGTADIN
SLAADGKLLKLNSRSTLAIDWDSETRSLYYDEQESEAYEKHVSMLQPQKKKKMAVALRDC
IELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTV
VEFPVRGLNMSEFVCDLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSN
VSLASEEQIVTKAAYVLFYQRRDDEFCKTPSLISFPGSSDGGMRPSSSQQGVGDDEACSM
DTN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggaggctgctgtgagcgaccggatgcagagacccagaaatccgagctc
ggggccttgatgaggaccacgctccaacgaggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggatatgtacaacgtgggt
gaacacaacttatttcccggcccgatagataactctggacttttttcagatcctgagagc
cagacattgaaagaacatttaattgatgaattggactatgtattggtcccaactgaggca
tggaataagttactaaactggtatggctgtgtagaaggccagcagcccatcgtcagaaaa
gttgtagagcatggtctgtttgtcaagcactgcaaggtggaggtgtatttgctagaactg
aagctctgtgagaatagtgaccccactaacgtgctgagttgccatttcagcaaagcagac
accatcgcaaccattgagaaggagatgcggaagctgtttaacattcctgcagagcgtgaa
acgcggctgtggaacaaatacatgagcaacacctatgagcagttgagcaagctggacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagccccaaaatgaa
gatggcacatggccaaggcagacccttcagtcaaaatcaagcactgtgcctagcagaaat
tttactacctctccaaaatcatcagcaagtccctattcctcagtgtctgcctctcccatt
gcaaatggtgatagcactaacacctctgggatgcgcagttccggtgtcagcaggggtgga
tctggcttctctgcttcatataattgtcaggagtctccatcgtctcacatacaacctggg
ctctgcggacttggaaacctggggaacacctgcttcatgaactccgctttgcagtgtttg
agcaacactgcaccactgactgactactttctcaaagatgagtatgaggccgaaatcaac
agagacaaccctctgggaatgaaaggggaaattgcagaagcctatgcagagctcattaag
cagatgtggtctggaagggatgctcatgtggcacctcgcatgttcaaaacccaagtggga
cgttttgcccctcagttttctggctatcagcaacaagactctcaggagctgttagccttt
cttctagatgggttgcacgaagatctgaaccgagtgaagaagaagccctacctggagctg
aaggatgccaatgggcggccagatgcggtggtggcaaaggaagcctgggagaatcacagg
ttgaggaatgactctgtgattgtggacacattccatggtctcttcaaatctactttggtt
tgcccagaatgtgctaaagtttctgtgacttttgacccattttgctatctaactctccca
ctgcccttgaagaaagatcgagttatggaggtcttcctcgttcctgctgaccctcgctgt
agacctacccagtatcgcgtgattgtgccgctgatgggggccgtgtctgacctgtgcgag
gctctctccaggctgtctggcattgctgcagagaacatggtggtcacagatgtgtataat
caccgattccacaaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gacattttcgtgtatgagacatgcagcacatcctcggacagctcagaatgtgtcacactt
ccagtctacttcagagagaggaagtccagaacatcgagtacttcctctggggcagtgttg
tatgggcagccactgctgatttctgtcccccggcacaagctaaccttcgaatctttgtac
gaggctgtttgtgagcgcatcagccgctatataaaacagcctttgcctgatgagtctggt
ggcttgcccttggagccgggggcctgcaatggctccaggggcagctgtgaaggagacgat
gaagaggaaatggagcatcaggaagaaggcaaagagcacctttcagaaacagaaggcagt
ggggaggatgagctgggaagtgaacatagtgagaccactcaaaagatcaaaggccagccc
tgtccgaaaaggctttttaccttcagccttgtgaactcctatggaacagctgacataaat
tcccttgcagctgacggaaaactacttaaactcaactctcgatccacactggccatcgac
tgggacagtgagacccggagcctttattatgatgagcaagaatctgaggcctatgagaag
cacgtaagcatgttgcagcctcagaagaagaaaaagatggcagtggctctgagagactgc
attgagctcttcaccaccatggagacccttggggagcatgacccttggtactgtcccaac
tgtaagaagcatcaacaggccacaaagaagtttgacttatggtctttgccaaagatcctg
gtggtccacctcaaacgtttctcctacaatagatactggagggataagctcgacacagtt
gtggaattcccagtcagaggtctgaacatgtccgagtttgtctgtgacctgtcagcaagg
ccttatgtgtatgacctcattgccgtgtccaatcattatggagccatgggagttggccac
tacactgcatatgcgaagaacaaactgaacgggaaatggtattactttgatgatagcaac
gtgtccctggcttctgaggagcagatagtgacaaaagcagcttacgtgctgttttaccag
cgtcgagacgatgagttttgtaagacaccttcactcatcagttttcctggatcctctgat
ggagggatgagaccaagcagctcacagcagggcgtgggggatgatgaggcttgcagcatg
gacaccaactga

DBGET integrated database retrieval system