KEGG   Equus caballus (horse): 100053539Help
Entry
100053539         CDS       T01058                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100053539 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100053539 (LAMB2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100053539 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100053539 (LAMB2)
   05222 Small cell lung cancer
    100053539 (LAMB2)
  Infectious diseases
   05165 Human papillomavirus infection
    100053539 (LAMB2)
   05146 Amoebiasis
    100053539 (LAMB2)
   05145 Toxoplasmosis
    100053539 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N APG6 F5_F8_type_C Sec5
Motif
Other DBs
NCBI-GeneID: 100053539
NCBI-ProteinID: XP_001498255
Ensembl: ENSECAG00000021805
UniProt: F7BK38
Position
16
AA seq 1836 aa AA seqDB search
MLPNFALSRWTLLVEGPPNGQRAEWGISQEPTRAGMERASGERGRDWRGQPAPWELRLGL
LLSVLATALAQALAPDVPGCSRGSCYPATGDLLVGRADRLTASSTCGLHGPQPYCIVSHL
QDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRAAWWQSENGVPVVTIQLDLEAE
FHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVC
ESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDP
RREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCE
QCQDFYHDLPWHPAEDGHSHACRKCECHGHAHSCHFDMAIYLASGNVSGGVCDGCQHNTA
GHHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDGGRCDPHDDPPLGLVSGQCRCKE
HVVGSRCQQCRDGFFGLSASDPVGCRRCQCDARGTVPGGTPCDPNSGTCFCKRLVTGHGC
NRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCNEATGQCRCRQHMVGRRCEQVQPGYFRP
FLDHLTWEAEDVQGQVLDVVERLVIPGGAPSWTGLGFVRLREGQALEFLVASVPRAMDYD
LLLRLEPQVPEQWAEMELTVQRPGPVSAHSLCGHVLPKDDYIPGTLQSDTRYMVLPRPVC
LEPGNSYKLHLKLVRTGGSAQPDAPYSGPSLLIDSLVLLPRVLVLEMFSAGDAAALERRA
TFERYRCHEEGLLPSKTLPSEACAPLLISLSTLLYNGALPCQCDPQGSLSSECNPHGGQC
LCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPEGALSSLCEGTSGQCPCRPGAFGLRCD
RCQRGQWGFPSCQPCVCNGHADECDTHTGTCLGCRDHTGGEHCERCIAGFYGDPRLPYGG
QCRPCPCPEGPGSRQHFATSCHQDGYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGR
CQPCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNL
LGTDPQQCPSTDRCNCDPSSGQCPCLPNVQGPSCDRCAPNFWNLASGHGCQPCACHPSRA
RGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRACDCDPRGIDTPQCHRSTGHC
SCRPGMSGVRCDQCARGFSGVFPACHPCHACFGDWDRVVQDLAARTRRLEQRAQELQQTG
VLGAFERSFWHMQEKLGTVQGIVGARNTSAASTAQFLEATEELRREIGEATEHLTQLEAE
LTDVQDENFNANHALSSLERDGLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSLSAE
AERRANTSALTVPSPVSNSAGIRHRTEVLMGAQREDFNRKYMANQQALGKLSARTHTLSL
TNINELVCGPPGDAPCATSPCGGAGCRDEDGQPRCGGLSCNGAAAMADLALGRARHTQAE
LQRALAEGGGILSQVAETRRQAGEAQQQAQAALDKANASRGQVEQANQELRELIQSVKDF
LSQEGADPDSIEMVATRVLELSIPASPEQIQHLAGAIAERVRSLADVDTILARTVGDVRR
AEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGAAQGAIQGAVVDTQDTEQTLHQV
QERMAGAEQALSSAGERAQQLDGLLEALKLKRAGNSLAASSAEETAGSAQGRAREAEQLL
QGPLGDQYQTVRALAERKAQGVLAAQARAEQLRDEARGLLQAAQDKLQRLQELEGTYEEN
ERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccaactttgctctaagtcgctggactctgctagtggagggaccgcccaacgga
cagagggcagagtggggaatcagccaagaacccacacgggcagggatggagcgggcctca
ggggaacgagggagggactggcggggacagcctgcgccctgggagctacgactgggcctg
ctgctgagcgtgctggccaccgccctggcccaggctctggccccggatgtgccaggctgt
tcgcggggaagctgctaccccgccacaggtgacctgctggtgggccgagctgacagactg
accgcctcatccacctgtggtttgcatggcccccagccctactgcatcgtcagtcacctg
caggacgaaaagaagtgctttctgtgtgattcccggcgccccttctctgctcgagacaac
ccaaacagccatcgcatccagaatgtagttaccagcttcgcaccacagcgcagagcagcc
tggtggcagtcagagaatggtgtccccgtggtcaccatccagctggacttggaggctgag
ttccatttcacgcacctcattatgactttcaagacatttcggcctgctgccatgctggtg
gagcgctcagcagactttggacgcacctggcatgtgtaccgatatttctcctatgactgt
ggggctgacttcccaggagttccactggcccccccacggcactgggatgacgtagtttgt
gagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgtgtgctg
gaccctgccatccctatcccagacccctacagttcacggatccagaacctgctgaagatc
accaacctacgggtgaacctgacacggctacacacgctgggggacaacctgcttgaccca
cgacgggagatccgtgagaagtactattatgccctctacgagctggttgtgcgtggcaac
tgcttctgctacggacatgcctcacagtgtgcacccgccccaggagcaccagcgcacgct
gagggcatggttcatggggcctgcatctgcaaacacaacactcgtggcctcaactgtgag
cagtgtcaggatttctatcatgatttgccctggcatccagccgaggatggccacagtcat
gcctgcagaaagtgtgagtgccatgggcatgcccacagctgccacttcgacatggccata
tacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcacaacacagct
gggcaccactgtgagctctgccgacccttcttctaccgtgacccaaccaaggatctgcgg
gacccggccgtgtgccgctcttgtgattgtgaccccatgggttcccaagacggtggtcgc
tgtgatccccatgatgatcctccactggggctggtttcgggccagtgtcgctgcaaagaa
catgtggtgggctctcgctgtcaacaatgccgtgatggcttctttgggctcagtgccagt
gaccctgtaggctgccggcggtgtcagtgtgatgcacggggtacagtgcctgggggcacc
ccttgtgaccccaacagtggaacctgtttctgcaagcgtctagtgactggacatggctgt
aaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgtccgtgt
gactgcgacgtgggtggtgccttggatccccagtgcaatgaggcaacaggtcagtgccgc
tgccgccagcacatggtagggcgacgctgtgagcaggtgcagcctggctacttccggccc
ttccttgaccacctaacttgggaggctgaggatgttcaagggcaggtgcttgatgtggtg
gagcgcctggtgatccctgggggagctccatcttggacaggcctgggctttgttaggctg
cgggaaggccaagcactggagttcctggtggcctctgtgccaagagccatggactacgac
ctgctgctgcgcttggagccccaggtccctgagcaatgggcagagatggaactgactgtg
cagcgcccagggcctgtgtctgcccacagcctgtgtgggcatgtgctgcccaaggatgac
tacatccctgggaccctgcaatcagacaccaggtacatggtgcttcccagacctgtctgc
cttgagcctggcaactcctacaagctgcatctgaagctggtgcgaacaggaggaagtgcc
cagcctgatgccccctactctggacccagcctgctcattgactcgctggtgctgctgccc
cgtgttcttgtgctggagatgtttagtgcgggtgatgctgctgccctagagcgccgtgcc
acctttgaacgctaccgctgccatgaggagggtctgctgcccagcaagactcttccctct
gaggcctgtgctccgctcctcatcagcctgtccaccctgctctacaacggtgctctgccc
tgtcagtgtgacccccagggctcactgagttctgagtgcaacccccatggtggccagtgc
ctgtgcaaacctgcagtggttgggcgccgctgtgacctctgtgcccctggctactatggc
tttggccccacaggctgtcaagcctgccaatgcagccctgaaggggcgctcagcagcctg
tgtgaagggaccagtgggcaatgcccctgccgacctggtgcctttgggcttcgctgcgac
cgctgccagcgtggccagtggggattccctagctgccagccatgtgtctgtaatgggcat
gcagacgaatgtgacacccacacaggcacttgcctaggctgccgtgatcacacagggggt
gagcactgtgaaaggtgtattgctggcttctatggggaccctcggctgccatatgggggc
cagtgccggccctgtccctgccctgaaggccccgggagccggcagcactttgccacttct
tgccatcaggacgggtactcccagcagatcgtgtgccactgcagggcaggctacacaggg
ctacggtgtgaagcttgtgcccctggccactttggggacccatcaaggccaggtggccgg
tgccaaccatgtgagtgcagtgggaacattgaccccatggaccctgatgcctgtgacccc
cacacggggcaatgcctgcgctgcttacaccacacagaggggccacactgtgcccattgc
aagcctggcttccatgggcaggctgcccggcagagctgtcaccgctgtacctgcaacctg
ctgggcacagatccccaacagtgcccatccactgaccgatgcaactgtgacccaagcagt
gggcagtgcccttgcctccccaatgtccagggccctagctgtgaccgctgtgcccccaac
ttctggaaccttgccagtggccatggctgccagccctgtgcctgccacccaagccgagcc
agaggccccacctgcaatgagttcacagggcagtgccactgccgtgctggctttggtggg
cgaacctgttctgagtgccaagagctccactggggagaccctgggttgcagtgccgtgcc
tgtgattgtgaccctcgtggaatagacacacctcagtgtcaccgctccacaggtcactgt
agctgccgcccaggcatgtctggtgtgcgctgtgaccagtgtgcccgtggcttctcaggt
gtctttcctgcctgccacccctgccatgcatgcttcggggactgggaccgtgtggtacag
gacttggctgcccgtacacggcgcctggagcagcgggcacaggagctgcagcagacgggt
gtgctgggtgcctttgagagaagcttctggcacatgcaagagaagctgggcactgtgcag
gggattgtgggtgcccgcaacacctcggctgcctccactgcgcagtttctggaggccaca
gaggagttgcggcgtgaaattggggaggccactgagcacctgacccagctggaggcagag
ctaacagatgtgcaggatgagaacttcaatgccaaccatgcactaagcagtctggagaga
gatgggcttgcacttaatcttacactgcggcagctggatcagcatctggacctgctcaaa
cattcaaacttcctgggtgcctatgacagcatccgccatgcccacagcctgtctgcagag
gcagaacgtcgtgccaacacatcggccctgacagtgcccagccccgtgagcaactcagca
ggcattcggcacaggacagaagtgctgatgggtgcccagagagaggacttcaaccgcaaa
tacatggccaaccagcaggcattgggcaagctctctgcccgtacccacaccctgagcctg
acaaacatcaatgaactggtatgtgggcccccaggggatgcaccctgtgctacaagccct
tgtgggggtgccggctgtcgggacgaggatgggcagccccgctgcgggggcctcagctgc
aacggggcagccgccatggcagacctggcactgggtcgggcccggcacacacaggcagag
ctgcagcgggcactggcagaaggtggtggcatcctcagccaggtggctgagacccgtcgg
caggcaggcgaggcacagcagcaggcccaggcggccctggataaggctaatgcttccagg
ggacaggtggagcaggccaaccaggaactgcgggaacttatccagagtgtgaaggacttc
ctcagccaggagggggctgatcccgatagcattgagatggtggccacaagagtactagag
ctctccatcccagcatcacctgagcagatccagcacctggcaggcgcaattgcagagcgg
gtccggagtctggcagatgtggacacgatcttggcgcgtactgtgggagatgtgcgtcgg
gcagagcagctactgcaggatgcacgtcgggcacggagccgggctgagggtgagaaacag
aaggcagagacagtacaggcggcactggaagaggcccagcgggcacaaggtgctgctcag
ggtgccatccagggggcagtggttgacacacaggacacggagcagaccctgcaccaggta
caggagaggatggcaggtgcagagcaggcactgagttctgcaggtgagcgggctcagcaa
ttggatggtcttttggaggctctcaaattgaaacgagcagggaatagcctggcagcctct
agcgctgaagagacagcaggcagtgcccagggtcgtgcccgagaggctgagcagctgctg
cagggtccactaggcgaccagtatcagacagtgagggccctggctgagcgcaaggcccag
ggtgtgctggctgcgcaggcgcgggcagagcaactgagggatgaggctcggggcttgttg
caggccgctcaggacaaactgcagcggctgcaagagctggagggcacttatgaggagaat
gagcgggcgctggagggcaaagcggcccagctggatggactggaggccagaatgcgcagc
gtgcttcaagccatcaacttgcaagtccagatctacaacacctgccagtga

DBGET integrated database retrieval system