KEGG   Equus caballus (horse): 100053587Help
Entry
100053587         CDS       T01058                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100053587 (USP19)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100053587 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 1361 aa AA seqDB search
MSGGASATGPRRGPPGLEEATSKKKQKDRANQESKNGDPRRGGSASTPREEQTKEELLLD
WRQSADEVIVKLRVGAGPLRLEEVDAAFTDTDCVVRLPGGRQWGGVFYAEIESSCTKVQA
RKGGLLQLALPKKVPLLTWPSLLKKPLGTQELVSELRCQENGQEPSPIALEPGPEPRRAK
QEARNQKRAQGRGEVGAGAGPGAQAGPSAKRAVHLRRGPEGEGSRDGPGPQGDAPSFLAE
PAPQAEAEEQLRVPPLNPQTCLLGSEENLALLAGEKAVSLRNDPVSTGVARSRDPEKEPE
SMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPG
CGPHTIFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARGAVGGAKV
AVPTGPTPLDSTPPGGAPHPLTGQEETRAVEKEKPKSRSEDTGLDGVAARTPMEHVAPKP
EPHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL
SNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVA
SKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHK
MRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSK
PIKFLVSISKENSSASEVLDSISQSVHVKPENLRLTEVIKNRFHRVFLPSHSLDTVSPSD
VLLCFELLSPELAKERVVVLEVQQRPQVPSIRISKCAACQRKQQSEDEKLKRCTRCYRVG
YCNQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARFSVSVFQPPF
QPGRMALESQGPGCTTLLSTSSLEAGDSERDPVQLPELQLVTPVAEGDTGVPRAWAAPDR
GPVPSMSGVSSEMLASGPVEVGSLPAGERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKID
ASNREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARA
GHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSF
IWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPND
RSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPARAGHSEHHPDLGP
AAEAAASQVRAYSGCPRPRVAVTLSEASRIWQELEAEEEPVPEGPAPLGPWGPQDWVGPP
PRGPTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggggccagtgccacaggcccgaggagagggcctccaggactggaggaggcc
accagtaagaagaagcaaaaggatcgagcaaaccaggagagcaagaatggagatcctagg
agaggtgggtcagcgtccactcctcgggaggagcagaccaaagaggagttgttgctcgat
tggaggcagagtgcagatgaagtgattgtcaagctgcgtgtgggagcgggtcccttgcgg
ctagaggaggtagatgctgctttcacagacacagactgtgtggtgcggcttccaggtggt
cggcagtggggtggtgttttctacgctgagatagaaagttcttgcaccaaagtacaggcc
cgcaaaggtggtctcctgcagctggcgctgcccaagaaggtgcctctgctcacatggccc
tctctcctgaagaaacctctagggacccaggagttggtgtcagagctgcggtgccaggag
aatgggcaggagccatctcccattgccctggagccaggccctgagccccgccgggctaag
caggaggcccggaaccagaagcgggcccagggccgtggtgaggtaggcgcgggggctggc
cctggggcccaagcagggcccagtgccaagagggctgtgcatctccgcagaggaccagaa
ggggaggggtccagagatggtcctggaccccaaggcgatgccccctccttcctggctgag
ccggccccccaggctgaagctgaggaacagctccgggtaccaccactgaacccccagacc
tgcctcctgggctcagaggagaatctagcacttttggcaggagagaaggctgtatccctc
aggaatgacccagtttccaccggcgtggcccggagcagagaccctgagaaagagcccgag
tccatggtgaacctggcatttgtcaagaatgactcgtatgagaaggggccagactcagtg
gtggtgcatgtgtacgtgaaggaaatccgcagggacacttctcgagtgcttttccgcgaa
caggacttcacgcttattttccagaccagagatggaaacttcctgagactgcacccaggc
tgtgggccccacaccatcttccgttggcaggtgaagctcaggaacctgattgagccagag
cagtgcaccttctgcttcacagcctctcgcattgatatttgcctccgtaagcggcagagt
cagcgctgggggggcctggaggctccagctgcacgaggtgcagtgggtggtgcaaaggtt
gccgtgccgacaggcccaactcctctggattcaaccccaccgggaggtgccccccacccc
ctgacaggccaggaggaaacccgggctgtggagaaggagaaacccaagtctcgctctgag
gacacagggctggatggtgtggcagcccgcacccccatggagcatgtagccccaaagcca
gagccacacctggcctcgcccaagcccacatgtatggtgcctccaatgccccatagccct
gtgagtggagatagtgtagaggaagaggaagaggaagagaagaaggtgtgtttgccgggt
ttcactggccttgtcaatctaggcaatacctgcttcatgaacagtgtcattcagtctctg
tctaatactcgggagctccgggacttcttccatgaccgctcctttgaggctgagatcaac
tacaacaaccctcttggaactggtgggcgtctggccattggctttgccgtgctgctccgg
gcactgtggaagggcacccaccatgccttccagccttccaagttgaaggccattgtggcg
agcaaagccagccagttcacaggctatgcacagcatgatgcccaggagttcatggctttc
ctgctggatgggctgcacgaggacctgaaccgcattcagaacaagccctacacggagact
gtggactcagatgggcggcctgatgaggtggtggctgaggaagcatggcagcggcacaag
atgaggaatgactctttcatcgtggacctatttcagggccagtataagtcgaagctggtg
tgccctgtgtgtgccaaggtctccatcacttttgacccatttctgtacctaccggtgccc
ttgccacagaagcaaaaggttctccctgtcttctattttgcccgggagccccacagcaag
cccatcaagttcctagtgagcatcagcaaggagaactccagtgcaagtgaagtgttggac
tctatctctcagagtgtccacgtgaagcctgagaacctgcgtctgactgaggtgattaag
aatcgctttcaccgtgtgttcttgccctcccactcactggacactgtgtccccatctgat
gtgctcctctgctttgagctcctatccccagagttggctaaggagcgggtggtggtgcta
gaggtgcagcagcgcccccaggtgcccagcatccgcatctccaagtgtgcagcctgccag
cggaagcagcaatcagaggatgagaagctgaagcgctgtacccggtgttaccgcgtgggc
tactgcaaccagctctgccagaaaactcattggcctgatcacaagggcctctgccgtcct
gagaacattggctacccattccttgtcagtgtacctgcctcacgcctcacttatgcccgt
cttgctcagctgctagagggctatgcccggttctctgtgagtgtattccagccacccttc
cagcctggccgcatggccttggagtctcagggccctggttgcaccacactgctctccact
agctccctggaggctggagacagtgagagggaccccgttcagctgcctgagctccagttg
gtgacccctgtggctgagggggacacaggggtcccccgggcatgggcagcccctgaccgg
ggccctgtgcccagcatgagtggagtttcttccgagatgctggccagtgggcccgttgaa
gttggctccttgcctgctggtgagagggtatcccggcctgaagctgctgtgcctgggtac
caacaccctagtgaagcaatgaatgcccacacgccccagttctttatctataaaattgat
gcgtccaaccgagagcagcggctagaagacaaaggagatacgccattagagctgggtgat
gactgcagcctggctctagtctggcggaacaatgaacgcctgcaggagttcgtattggtg
gcctccaaggagctggaatgtgctgaggatccaggctctgctggtgaggctgcccgcgct
ggccacttcactctggaccagtgcctgaacctcttcacgcggcctgaggtgctggcacct
gaggaagcttggtactgcccacagtgtaaacaacaccgcgaggcctccaagcagctattg
ctgtggcgcctgccaaatgtgctcatcgtgcagctgaagcgcttctcctttcgtagtttc
atatggcgtgacaagatcaatgacttggtggagttccctgttcggaacctggacctgagt
aagttctgcattggtcagaaagaggagcagctacccagctatgacctctatgctgtcatc
aaccattatggaggcatgattggtggccactacaccgcctgtgcacgcttgcccaatgat
cgcagcagccagcgcagcgacgtgggctggcgcttgtttgatgacagcacggtgacaaca
gtagatgagagccaggttgtgacgcgttatgcctatgtcctcttctaccgtcggcggaac
tctcctgtggagaggcccgcccgggcaggtcactctgagcaccacccagacctaggccct
gcagccgaagctgctgccagccaggtcagggcctattcaggctgtccacggcctagggtg
gccgtcaccctctctgaggcttcccggatttggcaggagctggaggccgaggaggagcca
gtacctgaggggcctgcgcccctgggtccctgggggccccaagactgggtgggccccccg
ccacgtggccctaccacaccagacgagggctgcctccggtactttgttctgggcaccgtg
gcagctttggtggccctcgtgctcaacgtgttctatcctctggtatcccagagtcgctgg
agatga

DBGET integrated database retrieval system