KEGG   Equus caballus (horse): 100053597Help
Entry
100053597         CDS       T01058                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01524  Platinum drug resistance
ecb04014  Ras signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04137  Mitophagy - animal
ecb04140  Autophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04621  NOD-like receptor signaling pathway
ecb04630  Jak-STAT signaling pathway
ecb05014  Amyotrophic lateral sclerosis (ALS)
ecb05145  Toxoplasmosis
ecb05166  HTLV-I infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100053597 (BCL2L1)
   04630 Jak-STAT signaling pathway
    100053597 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100053597 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100053597 (BCL2L1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100053597 (BCL2L1)
   04137 Mitophagy - animal
    100053597 (BCL2L1)
  Cell growth and death
   04210 Apoptosis
    100053597 (BCL2L1)
   04215 Apoptosis - multiple species
    100053597 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100053597 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100053597 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    100053597 (BCL2L1)
   05212 Pancreatic cancer
    100053597 (BCL2L1)
   05225 Hepatocellular carcinoma
    100053597 (BCL2L1)
   05220 Chronic myeloid leukemia
    100053597 (BCL2L1)
   05222 Small cell lung cancer
    100053597 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100053597 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    100053597 (BCL2L1)
   05145 Toxoplasmosis
    100053597 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100053597 (BCL2L1)
   01524 Platinum drug resistance
    100053597 (BCL2L1)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100053597 (BCL2L1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100053597 (BCL2L1)
Transporters [BR:ecb02000]
 Other Transporters
  Pores ion channels [TC:1]
   100053597 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100053597
NCBI-ProteinID: XP_005604607
Ensembl: ENSECAG00000017223
Position
22
AA seq 245 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWKETALGTFCYFVSSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQ
EMPLQ
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacaactggagtcagtttagtgacgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gacagccccacggggaatggagccactggccacagcagcagcttggatgcccgggaagtg
atccccatggcagcagtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacctggatggccacttacctgaatgaccacctagagcct
tggatccaagagaacggcggctggaaagaaactgctttggggaccttctgctacttcgtt
tcatccctgatgagactctcaggccaaggcggagccttacagctagctccaagctacagt
gctttttgggcagactccagagctcccctcggaactagaggtttttctctcgctcttcag
gaaatgccattgcaatga

DBGET integrated database retrieval system