KEGG   Equus caballus (horse): 100053608Help
Entry
100053608         CDS       T01058                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ecb  Equus caballus (horse)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100053608 (BPNT1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100053608 (BPNT1)
Transfer RNA biogenesis [BR:ecb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100053608 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 308 aa AA seqDB search
MASSHTVLMRLVASAYSIAQKAGAIVRRVIAEGDLGIVEKTSATDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPPEDVDQELIEDGQWEEILKQPCPSQYSSIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHNNKLVSDCVTAMNPDDVLRVGGAGNKILQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPE
SVKNALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtcacactgtgttgatgcggttggtagcctcagcatattctattgctcag
aaggcaggagcgatagtcagacgtgttattgctgaaggtgacctgggtatcgtggagaag
acctctgcgacagacctgcagaccaaagctgaccgattggtacaaatgagcatatgttct
tcactggcccggaagttccccaaactaacaattataggagaagaggatctgcctcctgaa
gacgtggatcaagagctgattgaagatggtcagtgggaggagatattgaagcaaccatgc
ccgtcacagtacagttctattaaagaagaagatcttgtggtgtgggttgatcctctggat
ggtaccaaggaatatactgaaggtcttcttgacaatgtaacagttcttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactaccaggcagga
ccagatgctgtgctgggaaggacaatctggggagttttaggtttaggtgcctttgggttt
cagctgaaagaagtgcctgctgggaaacacattatcacaactacccggtcccataacaac
aagttggttagtgactgtgttactgctatgaaccctgatgacgtgctgcgagtgggagga
gcaggaaataagattcttcagctgattgaaggcaaagcctctgcttatgtatttgcaagt
cctggatgtaagaagtgggatacttgtgctccagaagttattttacatgctgtaggaggc
aagttaaccgatatccatggaaatgcccttcagtacaacaaggaagttaagcatatgaac
tccgccggagtcctggccacgctgaggaattatgactactatgcaagtcgagttcctgaa
tctgttaaaaatgcactggttccttaa

DBGET integrated database retrieval system