KEGG   Equus caballus (horse): 100053616Help
Entry
100053616         CDS       T01058                                 

Gene name
B4GALNT1
Definition
beta-1,4-N-acetyl-galactosaminyl transferase 1
Orthology
K00725  
(N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
ecb  Equus caballus (horse)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ecb00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 374 aa AA seqDB search
MRGFGGKRLVFCGLNGVVRLGSDDLPHRSRLLSGNNCSCESSVGSLHLPFQRQVRAIDLT
KAFGPEELRAASALREQEFQAFLSRSQSAADQLLIAPANSPLQYPLQGVEVQPLRSILVP
GLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGRPDLTLASPGLDQLNRQLQLV
TYSSRSYQANTADTVRFSTEGHEAAFTIHIRHPPNPRLYPPGSLPQGGDAGQYNISALVT
IATKTFLRYNRLRALIASIRRFYPTVTVVIADDSDKPESVSGPVGLLHHSRPFIVYPFPP
PPEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDSGSETYARYRYPGSLDESQVAKHR
LLFFKHRLQCMTTE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggattcggaggcaaacggctggtgttttgtgggctgaatggagttgtacggctg
ggttctgatgaccttcctcaccgctccaggctgctgtctgggaacaactgtagttgtgag
tccagtgtggggagccttcacctccccttccagaggcaggtccgagccattgacctcacc
aaggcctttggccctgaggagctgagggctgcctctgccttgagggagcaggagttccag
gcgttcctttcaaggagccagtccgctgctgaccaactgctcatagcccctgccaactcc
cccctacaataccccctgcagggtgtggaggtccagcccctcaggagcatcttggtgcca
gggctgagcctgcaggccgcttctggtcaggaggtataccaggtgaacctgactgcctcc
ttgggcacctgggatgtggcaggggaagtgacaggagtgactctcactggagaggggcgg
ccagatctcaccctcgccagcccagggctggaccaactcaatcggcagctgcaactggtc
acttatagcagccgaagctaccaggcaaacacagcagacacagtccggttctccaccgag
ggacatgaggctgccttcaccatccacataagacacccccccaaccctcggctgtaccca
cctgggtctctaccccagggaggtgacgctggccagtacaacatcagcgctctcgtcacc
attgccacgaagaccttccttcgttacaatcggctacgggcactcatcgccagcatccgc
cgcttctacccgacggtcaccgtggtcatcgccgacgatagcgacaagccggagagcgtt
agcggcccggttggccttctgcaccactcaagacccttcattgtgtacccctttcctcca
cccccagaattcttcctggatgggcttggttcccttcgagtgggctcctgctcagacgtc
gttgtggatcatgcatcgaaattgaagctgccttggacgtcaagggattctgggtcagag
acttatgcccggtaccgttacccaggatcactggacgaaagtcaggtggccaaacaccgc
ctgctcttcttcaaacatcggctgcagtgcatgaccacagagtga

DBGET integrated database retrieval system