KEGG   Equus caballus (horse): 100053616Help
Entry
100053616         CDS       T01058                                 

Gene name
B4GALNT1
Definition
beta-1,4-N-acetyl-galactosaminyl transferase 1
Orthology
K00725  
(N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
ecb  Equus caballus (horse)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100053616 (B4GALNT1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.92  (N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase
     100053616 (B4GALNT1)
Glycosyltransferases [BR:ecb01003]
 Glycan extension
  Glycolipid
   100053616 (B4GALNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 374 aa AA seqDB search
MRGFGGKRLVFCGLNGVVRLGSDDLPHRSRLLSGNNCSCESSVGSLHLPFQRQVRAIDLT
KAFGPEELRAASALREQEFQAFLSRSQSAADQLLIAPANSPLQYPLQGVEVQPLRSILVP
GLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGRPDLTLASPGLDQLNRQLQLV
TYSSRSYQANTADTVRFSTEGHEAAFTIHIRHPPNPRLYPPGSLPQGGDAGQYNISALVT
IATKTFLRYNRLRALIASIRRFYPTVTVVIADDSDKPESVSGPVGLLHHSRPFIVYPFPP
PPEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDSGSETYARYRYPGSLDESQVAKHR
LLFFKHRLQCMTTE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggattcggaggcaaacggctggtgttttgtgggctgaatggagttgtacggctg
ggttctgatgaccttcctcaccgctccaggctgctgtctgggaacaactgtagttgtgag
tccagtgtggggagccttcacctccccttccagaggcaggtccgagccattgacctcacc
aaggcctttggccctgaggagctgagggctgcctctgccttgagggagcaggagttccag
gcgttcctttcaaggagccagtccgctgctgaccaactgctcatagcccctgccaactcc
cccctacaataccccctgcagggtgtggaggtccagcccctcaggagcatcttggtgcca
gggctgagcctgcaggccgcttctggtcaggaggtataccaggtgaacctgactgcctcc
ttgggcacctgggatgtggcaggggaagtgacaggagtgactctcactggagaggggcgg
ccagatctcaccctcgccagcccagggctggaccaactcaatcggcagctgcaactggtc
acttatagcagccgaagctaccaggcaaacacagcagacacagtccggttctccaccgag
ggacatgaggctgccttcaccatccacataagacacccccccaaccctcggctgtaccca
cctgggtctctaccccagggaggtgacgctggccagtacaacatcagcgctctcgtcacc
attgccacgaagaccttccttcgttacaatcggctacgggcactcatcgccagcatccgc
cgcttctacccgacggtcaccgtggtcatcgccgacgatagcgacaagccggagagcgtt
agcggcccggttggccttctgcaccactcaagacccttcattgtgtacccctttcctcca
cccccagaattcttcctggatgggcttggttcccttcgagtgggctcctgctcagacgtc
gttgtggatcatgcatcgaaattgaagctgccttggacgtcaagggattctgggtcagag
acttatgcccggtaccgttacccaggatcactggacgaaagtcaggtggccaaacaccgc
ctgctcttcttcaaacatcggctgcagtgcatgaccacagagtga

DBGET integrated database retrieval system