KEGG   Equus caballus (horse): 100053798Help
Entry
100053798         CDS       T01058                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 826 aa AA seqDB search
MGKKRTKGKTVPTDDSSESLEPMCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEETEENPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYLCD
DEVQYCTSNRLGQVVDYVRKQAGITTPKSAKDNGNIELENKKLEKESKNEQEREKKENMA
KENPSTNSPSQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPRELFSQVCKKAVRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFGSSTEKLDEELKNKVKDYEKKKSVPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSAKKSINDKNLKKTMEDEDKDSEEEKDN
DSYMKERNDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTVDHPEDNEC
EVEMSPQEEVDMNTNHISQEEVVHKDSYVNQKDLNGQEKMIEIVTDNQKSTEEVDMKNTN
MDNDLGVLASSPAECSRDLNGAHLKEGSDGEVDISSSFKDLSLNAALQPDEINIEILDDS
HTPGTKVYEVVNEDPETAFCTLANRETFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCT
RRQYNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPE
ILDLAPFCTLKCKNVAEENTKVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLH
GDIPQDFEMQSTKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERVL
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaactgatgattcttctgaatcttta
gaacctatgtgcagacacattagaaaaggattggaacaaggtaatttgaaaaaggcttta
gtgaacgtggaatggaatatttgtcaagattgtaagacagacaataaagtaaaagataaa
tctgaagaagaaacggaagaaaacccttcagtttggctgtgtcttaaatgtggccatcag
ggctgcggccgaaattctcaggagcagcacgccttgaagcactatctgacgccaagatct
gaacctcattgtctggttcttagtttggacaactggagtgtatggtgttacctatgtgat
gatgaggtccagtattgcacttcaaaccgattgggtcaggtggttgattatgttagaaaa
caagctggtattacaactccaaaatcagcaaaagataatggtaatattgaacttgaaaat
aaaaaattagaaaaggagagtaaaaatgaacaagagagagaaaaaaaggaaaacatggct
aaagaaaatccttccacgaattctccttcccaaataactgtgaaaggactcagtaatttg
ggaaatacatgtttcttcaatgcggttatgcagaatttgtcacagacacctgtgctgaga
gaactactaaaagaagtaaaaatgtctggaacaattgtaaaaattgagccacctgatttg
gcactaacagaacccttagaaataaaccttgagcctccaggccctcttactttagccatg
agccagtttcttaatgagatgcaagagaccaaaaagggaatcgtgacacctagagaactc
ttttctcaggtctgtaaaaaagcagtgcgatttaaaggctatcagcagcaagacagccag
gagctgcttcgatatttattggatggaatgagagcggaagaacatcaaagagtgagtaaa
ggaattcttaaagcatttggtagttctactgaaaaattggatgaagaactaaaaaataaa
gttaaagattatgaaaagaaaaaatcagtaccaagttttgtggaccgcatctttggtggc
gaactaactagtacaatcatgtgtgatgaatgcagaactgtctccttggttcatgaatct
ttccttgatctgtctctaccagttttagatgatcagagtgctaagaaaagtataaatgat
aaaaatctgaaaaagacaatggaggatgaagataaagacagtgaagaagaaaaagataac
gacagttacatgaaagagagaaatgatattccttcaggaacaagtaagcacttgcagaaa
aaagcaaagaagcaagccaaaaagcaagccaagaaccaacgaaggcaacaaaaaattcaa
gggaaagttcttcatttaaatgacatctgtaccgttgaccatcctgaagataatgaatgt
gaagttgaaatgtcacctcaggaagaagtggatatgaataccaaccatatctcacaagag
gaggttgtacataaagactcttacgttaatcagaaagatttgaatggccaagaaaaaatg
atagaaattgtaactgacaatcaaaaatccacagaggaagtagatatgaaaaataccaac
atggataatgatctgggggttttggcatcttctcccgctgaatgtagtagggatttaaat
ggtgcccacctgaaggaagggagcgatggagaagtggacatttccagtagtttcaaagac
cttagcttgaatgctgctctccagcctgatgaaataaatatagagattctggatgacagt
catactcctgggaccaaggtgtatgaggtcgtaaatgaagacccagaaactgctttctgt
actcttgcaaacagggagacttttaatactgatgagtgttccatccaacattgtttatat
cagttcacccgaaatgagaaacttcgagatgcaaataaactactttgtgaagtatgtacc
cggagacagtataatggaccaaaggcaaatataaaaggtgaaaggaaacatgtttacacc
aatgccaaaaaacagatgctaatttctcttgctcctcctgttctcactcttcatttaaag
agatttcagcaggctggttttaacctacgcaaagttaacaaacacataaaatttccggaa
atcttagatctggctcctttttgtacccttaaatgtaagaatgttgctgaagaaaataca
aaggtactgtattccttatatggagtcgttgaacacagtggtaccatgaggtcaggacat
tatactgcctacgccaaggcacgaactgcaaatagtcatctctctaatcttgttctccat
ggtgatattccacaagattttgaaatgcaatcaaccaaagggcagtggtttcacatcagt
gatacgcatgtgcaagctgtgcctacaactaaagtactaaactcacaagcgtacctccta
ttttatgagagagtactctaa

DBGET integrated database retrieval system