KEGG   Equus caballus (horse): 100053889Help
Entry
100053889         CDS       T01058                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  Jak-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04714  Thermogenesis
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04926  Relaxin signaling pathway
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100053889 (SOS1)
   04010 MAPK signaling pathway
    100053889 (SOS1)
   04012 ErbB signaling pathway
    100053889 (SOS1)
   04630 Jak-STAT signaling pathway
    100053889 (SOS1)
   04068 FoxO signaling pathway
    100053889 (SOS1)
   04072 Phospholipase D signaling pathway
    100053889 (SOS1)
   04151 PI3K-Akt signaling pathway
    100053889 (SOS1)
   04150 mTOR signaling pathway
    100053889 (SOS1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100053889 (SOS1)
   04540 Gap junction
    100053889 (SOS1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100053889 (SOS1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100053889 (SOS1)
   04660 T cell receptor signaling pathway
    100053889 (SOS1)
   04662 B cell receptor signaling pathway
    100053889 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100053889 (SOS1)
   04062 Chemokine signaling pathway
    100053889 (SOS1)
  Endocrine system
   04910 Insulin signaling pathway
    100053889 (SOS1)
   04912 GnRH signaling pathway
    100053889 (SOS1)
   04915 Estrogen signaling pathway
    100053889 (SOS1)
   04917 Prolactin signaling pathway
    100053889 (SOS1)
   04926 Relaxin signaling pathway
    100053889 (SOS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100053889 (SOS1)
  Environmental adaptation
   04714 Thermogenesis
    100053889 (SOS1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100053889 (SOS1)
   05231 Choline metabolism in cancer
    100053889 (SOS1)
   05206 MicroRNAs in cancer
    100053889 (SOS1)
   05205 Proteoglycans in cancer
    100053889 (SOS1)
   05210 Colorectal cancer
    100053889 (SOS1)
   05225 Hepatocellular carcinoma
    100053889 (SOS1)
   05226 Gastric cancer
    100053889 (SOS1)
   05214 Glioma
    100053889 (SOS1)
   05221 Acute myeloid leukemia
    100053889 (SOS1)
   05220 Chronic myeloid leukemia
    100053889 (SOS1)
   05211 Renal cell carcinoma
    100053889 (SOS1)
   05215 Prostate cancer
    100053889 (SOS1)
   05213 Endometrial cancer
    100053889 (SOS1)
   05224 Breast cancer
    100053889 (SOS1)
   05223 Non-small cell lung cancer
    100053889 (SOS1)
  Substance dependence
   05034 Alcoholism
    100053889 (SOS1)
  Infectious diseases
   05160 Hepatitis C
    100053889 (SOS1)
   05165 Human papillomavirus infection
    100053889 (SOS1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100053889 (SOS1)
   01522 Endocrine resistance
    100053889 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100053889
NCBI-ProteinID: XP_005600089
Ensembl: ENSECAG00000017604
UniProt: F6RQQ4
Position
15
AA seq 1333 aa AA seqDB search
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVNRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKDLINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISE
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgccggcgctgaaaaaggtccaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaggaattaattttgcagttattaaatatgctatgc
caagctcagcctcgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccgattgataagtgggcaatagctgatgcccagtcagctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagagtatatttctgcagac
attttaaagctggtagggaattatgtacggaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagaaccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacaatacataagggaactaaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtagatatacacgaacttagtgtaaagttactg
ggccacatagaagatactgtagaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggctttcatgatcatttccttagtcagctatcaaagcctggagca
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggatgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcgaatcatgggcaaccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtgacaatgctacag
gaggagaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagccc
gactctgaagagaatattatatttgaagaaaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacataccacatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaactg
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacccttgagtgcagaactaaaaaggtttagaaaagag
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagaacaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaacttactttacttgaatcagatctgtatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcacaccactaatctcactttgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgaatcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggcgtccttgaggttgttagtgctatgaactca
tcacctgtttacagactagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctgaaaaggcatggaaaagaccttataaactttagcaaa
aggaggaaggtagcagaaattacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcggatatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaat
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagagagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttccagtaccacagat
gtttgcagcgtatttgattctgatcattcgagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaaaggcactgatgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacgctattcaatatcagag
cggacctctatatcagaccctcctgagagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatggcaatgccttcttcccaaacagcccttctccctttacaccacctcct
cctcaaacaccttctcctcacggcacgagaaggcatctgccgtcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcccgttcctcctcgacaaagcacttctcag
catatccctaaactccctcccaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system