KEGG   Equus caballus (horse): 100053908Help
Entry
100053908         CDS       T01058                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100053908 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100053908 (PLA2G15)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100053908 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 408 aa AA seqDB search
MGLRLCPYRAALLPGGLLLLLLLADPALPGGRPPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTDKYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGNTFSL
EFLDPSKSSVGSYFHTMVESLVSWGYTRDKDIRGAPYDWRRAPNENGPYFLALRKMIEKM
HQQYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIHAFVALGAPWGGVAKTLRVLASGD
NNRIPVIGTLKIREQQRSAVSTSWLLPYNYTWSSEKVFVRTPTTNYTLRDYHRFFQDIGF
EDGWLMRQDTEGLVEATLPPGVQLHCLYGTGVPTPDSFSYENFPDHDPKIFFGDGDGTVN
LQSALQCRTWRSHQEHQVSLQELPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggggctccgcctctgcccctaccgcgcggccctgctcccaggtggcctcctgttgctc
ctgctgctcgcggatccggcgctcccgggcggacgtcccccgccggtggtgctggtgcct
ggtgatttgggcaaccagctggaggcaaagctggacaagccaacagttgtgcactacctc
tgctccaagaggacggacaaatacttcacactctggctgaacctcgaactgctgctgcct
gtcatcattgactgctggattgacaatatcaggctggtctacaacagaacatcccgagcc
acccaatttcccgatggtgtggatgtgcgtgtccctggctttgggaacaccttctcactg
gagttcctggaccccagcaaaagcagtgtgggttcctatttccacaccatggtggagagc
ctggtgagctggggctacacacgggataaggacatccggggggccccctacgactggcgc
cgagccccaaatgaaaatgggccctacttcctggccctccggaagatgatcgagaagatg
caccagcagtatgggggccccgtggtgctggttgcccacagtatgggcaacatgtacatg
ctctactttctgcagcggcagccacaggcctggaaggacaagtatatccatgccttcgtg
gcactaggtgcaccctgggggggcgtggccaagaccctgcgtgtcctggcctcaggagac
aacaaccggatcccggtcattggtaccctgaagatccgggagcaacagcggtctgctgtc
tctaccagctggctcctgccctacaactatacctggtcatctgagaaggtctttgtgcgc
acacccaccaccaactacacgttgcgggactatcaccggttcttccaggacattggcttt
gaagacggctggctcatgcggcaggatacagaggggctggttgaagccacactgccgcct
ggtgtgcagctgcactgcctctatggtactggtgtccccacaccagactccttctcctac
gagaactttccagaccacgaccctaaaatcttctttggcgatggtgatggcactgtgaac
ttgcagagtgccctgcaatgccggacctggcgcagccaccaggagcaccaagtgtcattg
caggagcttccgggcagtgagcacattgagatgctggccaatgccactactctggcctac
ctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system