KEGG   Equus caballus (horse): 100053916Help
Entry
100053916         CDS       T01058                                 

Gene name
MAPK4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100053916 (MAPK4)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100053916 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 583 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVNFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKAELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAANQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSQSSSERFLEQSHSSMERAFEADY
GHSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTAAVAADPGARED
EPASLFLEIAQWXKSTQGGPEHSSPPREGPERRLSASPPGRPAPIDGGASPHFDVVGFIS
RALKLCTKPEDLPDNKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagggcgactgcatcgccagtgtctatgggtatgacctcggtgggcgcttc
gttaacttccaacccctgggcttcggcgtcaatgggctggtgctgtcagccgtggacagc
agggcatgccggaaggtggccgtgaagaagatcgccctgagtgacgcccgcagcatgaag
catgcgctccgagagatcaagatcatccggcgcctggaccacgacaacatcgtgaaggtg
tacgaggtgctggggcccaagggcactgacctgcagggcgagctgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagaccgacctggctcgcctgctggagcagggcacg
ctgacagaggagcacgcaaagctattcatgtaccagctgctccgtgggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcatcagcacggag
gaccttgtgctcaagattggtgatttcgggttggcaaggatcgtggaccagcattattca
cacaagggtcatctgtcagaagggttggtaacgaagtggtaccgctcacctcgcctgctc
ctctcccccaacaactacaccaaagccatcgacatgtgggccgccggctgcatcctggcc
gagatgctcacggggagaatgctctttgcaggggcacacgagctggagcagatgcagctc
atcctggagaccatccctgtgatccgggaggaggacaaggctgagctgctcagggtgatg
ccttccttcgtcagcagcacctgggaggtgaagaggccgctgcgcaagctgctccccgaa
gtgaacagcgaagccattgactttctcgagaagatcctgacctttaaccccatggatcgc
ctcacagccgagatggggctgcagcacccctacatgagcccctactcatgccccgaggac
gagcccacctcgcagcaccccttccgcatcgaggatgagattgacgacatcctgctgatg
gccgccaaccagagccagctctccaactgggacaggtaccctgtgagcttgtcgtcggac
ctggagtggcggcccgaccggtgccaggacgcgagcgaggtgcagcgcgacccacgcgcg
ggctcggcgccgctggcggaggacgtgcaggtggacccgcgcaaggactcgcagagcagc
tccgagcgcttcctggagcagtcgcattcgtccatggagcgcgccttcgaggccgactac
gggcactcctgcgactacaaggtggggtcgccgtcctacctggacaagctgctgtggcgc
gacaacaagccgcaccactactcggagcccaagctcatcctggacctgtcgcactggaag
caggcggccggtgcgccccccaccgccgcggtggccgcggatcccggggctcgcgaggat
gagcctgccagcctcttcctggagatcgcgcagtggntcaagagcacgcagggcggccct
gagcactccagcccgccccgcgagggccccgagcgccgcctgtctgcctctccgcccggc
cgcccggccccaatagacgggggcgccagccctcatttcgacgtggtaggtttcatctcc
cgcgccctcaagctctgcaccaagcccgaggacctgccggacaataaactgggcgacctc
aacggcgcgtgcatctccgagcatcctggggatctcgtgcagaccgaggccttctccaaa
gaaaggtggtga

DBGET integrated database retrieval system