KEGG   Equus caballus (horse): 100053958Help
Entry
100053958         CDS       T01058                                 

Gene name
CYCS
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
ecb  Equus caballus (horse)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100053958 (CYCS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100053958 (CYCS)
   04115 p53 signaling pathway
    100053958 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100053958 (CYCS)
   05210 Colorectal cancer
    100053958 (CYCS)
   05222 Small cell lung cancer
    100053958 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100053958 (CYCS)
   05012 Parkinson's disease
    100053958 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    100053958 (CYCS)
   05016 Huntington's disease
    100053958 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    100053958 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100053958 (CYCS)
  Infectious diseases
   05134 Legionellosis
    100053958 (CYCS)
   05152 Tuberculosis
    100053958 (CYCS)
   05164 Influenza A
    100053958 (CYCS)
   05161 Hepatitis B
    100053958 (CYCS)
   05168 Herpes simplex infection
    100053958 (CYCS)
   05145 Toxoplasmosis
    100053958 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatacc
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctatttgggcgaaag
acgggtcaggcccctggcttctcttacacagatgccaacaagaacaaaggcatcacctgg
aaagaggaaacactgatggaatatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagaagacagaaagagaagacttaatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system