KEGG   Equus caballus (horse): 100054066Help
Entry
100054066         CDS       T01058                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ecb  Equus caballus (horse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100054066 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100054066 (SPHK2)
   04020 Calcium signaling pathway
    100054066 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100054066 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100054066 (SPHK2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100054066 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 654 aa AA seqDB search
MNGHLEAEEQRDQRPDQELTWSWGHGSRSALDRAEAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTPQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDPAAYLCIYTY
PRGRRGGRRRAARTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPELLPRP
PRLLLLINPFGGRGLAWQWCKDHVLPMISEAGLSFNLIQTERQNHARELVQGLRLSEWDG
IVTVSGDGLLYEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQYGGFERALGIDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLAVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHGLPRAKSELTLAPAPAPPVAHSPLHRSV
SDLPLPLPQPALMSPGSPEPPPLLSINGGDPELAGDWAAAGDSPLSPDPLLPSLPGSPKA
ALLSPITEGAPEMPASSGLLPPTPDAPAAISTGGPPDHLLPPLGTPLPPGWVTLEGDFVL
MLAISPSHLGAELVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGNQFSLGCPQL
GYAAAHAFRLEPLTPRGVLTVDGEQVEYGPLQAQVHPGLGTLLTGPPGRPGREP
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaggcagaggagcagcgggaccagaggccagaccaggagctgacc
tggagctggggccacgggtctaggagcgccctggacagggccgaggccatggccccgccg
ccgccgccactggccgccagcaccccactcctgcatggcgagtttggctcctacccagcg
cgtggcccacgcttcgccctcactctcacaccacaggccctgcacatccagcggctgcgc
ccaaagcctgaggcacggccccggggtggcctggtcccgctggccgaggtctcaggctgc
tgcaccctgcggagccgcagcccctcagacccagcagcctacctctgcatctacacctac
ccgaggggccggcgcgggggccggcgcagagccgcacgcacctttcgggccgacggggcg
gccacctacgaggagaaccgagctgaggcccagcgctgggccactgccctcacatgtctg
ctccgaggactgccactgcctggggacggggaaatcacccccgagcttctgccaaggccg
ccccgattgctcctgttgatcaacccctttgggggccggggcctggcgtggcagtggtgt
aaggaccacgtgctgcccatgatctctgaagctggactgtccttcaacctcatccagaca
gaacggcagaaccacgcccgagaactggtccaggggctgaggctgagcgagtgggacggc
atcgtcacagtctcgggagacgggctgctgtacgaggtgctgaatggacttctagatcgc
cctgactgggaagaggctgtgaagatgccggtgggcatcctgccctgtggctcgggcaat
gccttggccggagctgtgaaccagtatggcgggtttgagcgggccctgggcatcgacctg
ctgctcaactgctcactgctgctctgccgaggtggcggccacccgctggacctgctctct
gtgacgctggcctcaggctcccgctgcttctccttcctggctgtggcctggggctttgtg
tcagacgtggacatccagagcgagcgcttccgggccttgggcagtgcccgctttacgctg
ggcactgtgctgggtctggccacgctgcacacctaccgcggacgcctctcctaccttcct
gccactgtggaacctgcctcacccacccctgcccatggcctgccccgtgccaagtcagag
ctgaccctggccccagccccagccccgcctgtggcccactcacccctgcatcgctcagtg
tctgacctgcccctgcccctgccccagcctgccctgatgtcccctggctcacctgagccc
ccaccccttctgtccatcaatgggggggacccagagctggccggggactgggctgcagct
ggggattctccactgtccccagacccgctgctgccctcgctccctggatcccccaaggca
gctctactgtcacccatcactgagggggccccagaaatgccagcgtcctctgggctcctg
cctcccacccctgatgccccagcagccatctctactgggggtccacccgaccacctgctc
cctcctctgggcaccccactacccccaggctgggtgacgctggaaggggactttgtgctt
atgttggccatatcacccagccacctgggggctgagttagtggcagctccccacgcgcgc
tttgatgacggcctggtgcacctgtgctgggtgcgcagcggcatctcgcgggctgcgctg
ctgcgccttttcctggccatggagcgcggtaaccagttcagcctgggctgtccacagctg
ggctatgccgcggcccatgccttccgcctggagccgctcacgcctcgcggcgtgctcacg
gtggacggggagcaggtggagtatgggccgctgcaggcgcaggtgcacccgggcctcggt
acgctgctcaccgggcctcccggccgcccggggcgggagccctga

DBGET integrated database retrieval system