KEGG   Equus caballus (horse): 100054079Help
Entry
100054079         CDS       T01058                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100054079 (GALM)
   00052 Galactose metabolism
    100054079 (GALM)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100054079 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 342 aa AA seqDB search
MVSVTRAVFGDLPLGAGTVEKFQLQSDLLKVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYFQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLPINNGPNSLHGGVRGFDKVLWTP
QVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQEFHLG
GFDHNFCLKRSKEKHFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAVYPK
HSGFCLETQNWPDAVNQPHFPPVLLRPGDEYDHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgacgagagcagtgtttggagacctgcccttgggggcagggacagtggag
aagttccagctgcagtccgacctgctgaaagtggacatcatctcctggggctgcaccatc
acggccctggaggtcaaagacaggcagggcagagcctccgatgtggtgctcggctttgca
gagttggaagggtacttccaaaagcagccctactttggagctgtggttggcagggtggcc
aaccgaattgccaaaggaacattcacattggatgggaaggagtataaactgccaattaac
aacgggcccaacagtctgcatggaggagtcagagggtttgataaggtcctctggacgcct
caagtgctgtcaaatggtgtccagttctctcgggtcagtccagatggtgaggaaggttac
cctggagagttaaaagtctgggtgacatataccctggatggcggggagctggtggtcaac
tatcgagcccaggccagtcagaccacaccggtcaatctgaccaaccattcttatttcaac
ctggccggccagggttccccaaatatatatgaccatgaagttacaatagaagctgatgct
tttttgcctgtggatgaaaccctgattcctacaggagaagttgctccagtgcaaggaact
gcatttgacctgaggaaaccagtggagcttggaaaacacctacaggagtttcacctcggt
ggctttgaccacaatttctgtctgaagagatccaaagaaaagcatttttgtgcccgggtc
catcatgctggaagcgggcgggtactggaagtgtacaccacccagcccggggttcagttt
tacacgggcaacttccttgatggcacactaaagggcaagagtggagcagtctatcccaag
cactccggtttctgcctcgagacccagaactggcctgatgcggtcaatcagccccacttc
cctcctgtgctgctgcggcctggtgacgagtatgaccacaccacttggtttaagttttct
gtggcttaa

DBGET integrated database retrieval system