KEGG   Equus caballus (horse): 100054109Help
Entry
100054109         CDS       T01058                                 

Gene name
HBB
Definition
hemoglobin, beta
Orthology
K13823  
hemoglobin subunit beta
Organism
ecb  Equus caballus (horse)
Pathway
African trypanosomiasis
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Infectious diseases
   05144 Malaria
    100054109 (HBB)
   05143 African trypanosomiasis
    100054109 (HBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 147 aa AA seqDB search
MVQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPK
VKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFG
KDFTPELQASYQKVVAGVANALAHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaactgagtggtgaagagaaggcagctgtcttggccctgtgggacaaggtgaat
gaggaagaagttggtggtgaagccctgggcaggctgctggttgtctacccatggactcag
aggttctttgactcctttggggatctgtccaatcctggtgctgtgatgggcaaccccaag
gtgaaggcccacggcaagaaagtgctacactcctttggtgagggcgtgcatcatcttgac
aacctcaagggcacctttgctgcgctgagtgagctgcactgtgacaagctgcacgtggat
cctgagaacttcaggctcctgggcaacgtgctggttgttgtgctggctcgccactttggc
aaggatttcaccccagagttgcaggcttcctatcaaaaggtggtggctggtgtggccaat
gcactggcccacaaataccactga

DBGET integrated database retrieval system