KEGG   Equus caballus (horse): 100054109Help
Entry
100054109         CDS       T01058                                 

Gene name
HBB
Definition
(RefSeq) hemoglobin subunit beta
  KO
K13823  
hemoglobin subunit beta
Organism
ecb  Equus caballus (horse)
Pathway
African trypanosomiasis
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Infectious diseases
   05144 Malaria
    100054109 (HBB)
   05143 African trypanosomiasis
    100054109 (HBB)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100054109 (HBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
7
AA seq 147 aa AA seqDB search
MVQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPK
VKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFG
KDFTPELQASYQKVVAGVANALAHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaactgagtggtgaagagaaggcagctgtcttggccctgtgggacaaggtgaat
gaggaagaagttggtggtgaagccctgggcaggctgctggttgtctacccatggactcag
aggttctttgactcctttggggatctgtccaatcctggtgctgtgatgggcaaccccaag
gtgaaggcccacggcaagaaagtgctacactcctttggtgagggcgtgcatcatcttgac
aacctcaagggcacctttgctgcgctgagtgagctgcactgtgacaagctgcacgtggat
cctgagaacttcaggctcctgggcaacgtgctggttgttgtgctggctcgccactttggc
aaggatttcaccccagagttgcaggcttcctatcaaaaggtggtggctggtgtggccaat
gcactggcccacaaataccactga

DBGET integrated database retrieval system