KEGG   Equus caballus (horse): 100054193Help
Entry
100054193         CDS       T01058                                 

Definition
(RefSeq) histone H2B type 2-E-like
Organism
ecb  Equus caballus (horse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKVQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcctgctaagtccgccccagcccctaaaaagggttccaagaaggccgtgact
aaggtgcagaagaaagatggcaagaaacgcaaacgaggccgtaaggaaagctattctatc
tatgtttataaggtgttgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaatgacatcttcgaacgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacctccagagagatccagacggccgtgcgc
ctgctactgcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaaataa

DBGET integrated database retrieval system