KEGG   Equus caballus (horse): 100054233Help
Entry
100054233         CDS       T01058                                 

Gene name
PLCD1
Definition
phospholipase C, delta 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100054233 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100054233 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100054233 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100054233 (PLCD1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100054233 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 776 aa AA seqDB search
MQCLGVRRRSRSRELYLQEQSLKVAALNGQRLGLQDDKDLQALLKGGQLLKVKSSSWRRE
RFYKLQEDCKTIWQESRKVMRTPESQMFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSI
VFKDQRNTLDLIAPSPADAQHWVQGLRKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNK
MSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTHRKEIDSTFA
KAAGARETLSVDQLVAFLQHQQREEAAGPALALSLIERYEPNETAKAQRQMTKDGFLMYL
LSADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRC
LELDCWDGPNQEPVIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQQ
VMARHLRTILGPMLLDRPLDGATTSLPSPEQLKGKILLKGKKLGGLMPAGGEGSPEATVS
DEDEAAEMEDEAVRSRVQHKAKEDKLRLVKELSDMVIYCKSVHFGGFSSSGTPGQAFYEM
ASFSENRALRLLQESGNSFVRHNVGHLSRIYPAGWRTDSSNYSPVDMWNGGCQIVALNFQ
TPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNSTFNSCALAQGPWWTQKKLSVTVISGQQ
LPKVNKNKNSIVDPKVTVEIHGVGKDTASRQTPVVTNNGFNPWWDTEFEFEVVVPELALV
RFVVEDYDASSKNDFIGQSTIPLSSLKQGYRHVHLLSKNGDQHPSATLFVKVSLQD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcctcggggtccggaggcggagccgctccagagagctctacctgcaggagcag
agtctcaaagtggcggcgctcaatgggcagaggctgggcctgcaggatgacaaggaccta
caggcactgctgaagggcggccagctcctgaaggtgaaatctagctcatggcggagggag
cgcttctacaagttgcaggaagactgcaagaccatctggcaggagtcccgcaaagtcatg
cggaccccggagtcccagatgttttccattgaggacattcaggaggtgcggatggggcac
cgcacagaaggccttgagaagtttgcccgtgatgtgcccgaggaccgctgcttctccatt
gtcttcaaggaccagcgcaacacgctagacctcatcgccccatcgccagctgacgcccag
cactgggtgcagggtttgcgcaagatcatccaccactcgggctccatggaccagcagcag
aagctgcggcactggatccactcctgtttgcgaaaagctgataaaaacaaggacaacaag
atgagcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagc
tatgcccggaagatcttcagggaatgtgaccactcccagacagactccctggaggatgag
gagattgaggccttctacaagatgctgacccaccggaaagagatcgacagcacctttgcc
aaggccgcgggcgccagggagaccctgtcggtggatcagttagtggcattcttgcagcac
cagcagcgggaggaggcggcagggcctgcactggccctttccctcattgagcgctatgag
cccaatgagactgccaaggctcagcggcagatgaccaaggacggcttcctcatgtacctc
ctatcggccgatggcagcgcctttagcctggcgcaccggcgggtctaccaggacatgggc
cagccgctcagtcactacctggtgtcctcctcgcacaacacctacctgctggaagaccag
ctcaccgggcccagcagcactgaggcctacatacgggcgctgtgcaaaggctgccgctgc
ctggagctcgactgctgggacgggcccaaccaggagccagtcatctaccacggttacact
ttcacctccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaag
gcgtccccctaccccgtcatcctgtccctggagaaccactgcagccttgagcagcagcag
gtgatggcacgacacctgcgcaccattctgggacccatgttgttggaccggccgctggac
ggggctaccacaagcctgccttcccctgagcaacttaaggggaagatcttgctgaagggg
aagaagcttggggggctcatgcccgccggaggggaaggcagccctgaggccactgtgtca
gatgaggatgaggctgcggagatggaggatgaggcagtgaggagccgagtgcagcacaag
gccaaggaggacaagctcaggctagtgaaggagctctccgacatggtcatttactgcaaa
agcgtccactttgggggcttctccagctctggcaccccagggcaggctttctatgagatg
gcgtccttctctgagaaccgcgccctccgactcctccaagaatcagggaacagctttgtc
cgccacaacgtgggtcacctgagcaggatctacccagctgggtggagaacggactcctcc
aactacagccccgtggacatgtggaacgggggctgccagatcgtggccctgaacttccag
acacctgggccagagatggacgtgtaccagggccgcttccaggacaatggggcctgtggg
tatgtgctgaagcctgccttcctacgagaccccaactccaccttcaactcatgtgccctg
gctcagggcccctggtggactcagaagaagctcagtgtcacggtcatctcagggcagcag
ttgccaaaagtcaataagaataaaaattcgattgtggaccccaaggtgacagtggagatt
catggtgtgggcaaagacacagccagccgccagacccccgtagtcaccaataatggtttc
aacccgtggtgggacacggagtttgagtttgaggtggttgtgcctgagcttgcccttgtg
cgctttgtggtagaggattatgatgcctcctccaagaatgacttcattggccagagcacc
atccctctgagcagtctcaagcagggataccgtcacgtccacctcttgtccaagaatgga
gaccagcacccatctgccaccctctttgtgaaggtgtccctccaggactag

DBGET integrated database retrieval system