KEGG   Equus caballus (horse): 100054233Help
Entry
100054233         CDS       T01058                                 

Gene name
PLCD1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 isoform X1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04020  Calcium signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04919  Thyroid hormone signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100054233 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100054233 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100054233 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100054233 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100054233 (PLCD1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100054233 (PLCD1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100054233 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100054233 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH PH_12 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 100054233
NCBI-ProteinID: XP_001489064
Ensembl: ENSECAG00000023703
UniProt: F6XW20
Position
16
AA seq 855 aa AA seqDB search
MPFWSHLPGHQSRPPGTGFSSRPAPRAEDTPLWARPRLLDSSSAPLRLNSALLPALAGFW
RLRRCPGPGSRAAGALRGIMQCLGVRRRSRSRELYLQEQSLKVAALNGQRLGLQDDKDLQ
ALLKGGQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQMFSIEDIQEVRMGHR
TEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVQGLRKIIHHSGSMDQQQK
LRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEE
IEAFYKMLTHRKEIDSTFAKAAGARETLSVDQLVAFLQHQQREEAAGPALALSLIERYEP
NETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQL
TGPSSTEAYIRALCKGCRCLELDCWDGPNQEPVIYHGYTFTSKILFCDVLRAIRDYAFKA
SPYPVILSLENHCSLEQQQVMARHLRTILGPMLLDRPLDGATTSLPSPEQLKGKILLKGK
KLGGLMPAGGEGSPEATVSDEDEAAEMEDEAVRSRVQHKAKEDKLRLVKELSDMVIYCKS
VHFGGFSSSGTPGQAFYEMASFSENRALRLLQESGNSFVRHNVGHLSRIYPAGWRTDSSN
YSPVDMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNSTFNSCALA
QGPWWTQKKLSVTVISGQQLPKVNKNKNSIVDPKVTVEIHGVGKDTASRQTPVVTNNGFN
PWWDTEFEFEVVVPELALVRFVVEDYDASSKNDFIGQSTIPLSSLKQGYRHVHLLSKNGD
QHPSATLFVKVSLQD
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctggtcccacctccctgggcatcagtcccgcccccccgggactggattttcc
tctcgccccgcccccagagccgaggacacgcccctttgggcccggccccgcctcctggat
tctagctccgcccctctacgcctgaactccgccctgctccccgccttggccggcttctgg
aggctgcggcgctgtcccgggccaggctcgcgggcggcaggggcactgcggggcatcatg
cagtgcctcggggtccggaggcggagccgctccagagagctctacctgcaggagcagagt
ctcaaagtggcggcgctcaatgggcagaggctgggcctgcaggatgacaaggacctacag
gcactgctgaagggcggccagctcctgaaggtgaaatctagctcatggcggagggagcgc
ttctacaagttgcaggaagactgcaagaccatctggcaggagtcccgcaaagtcatgcgg
accccggagtcccagatgttttccattgaggacattcaggaggtgcggatggggcaccgc
acagaaggccttgagaagtttgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaacacgctagacctcatcgccccatcgccagctgacgcccagcac
tgggtgcagggtttgcgcaagatcatccaccactcgggctccatggaccagcagcagaag
ctgcggcactggatccactcctgtttgcgaaaagctgataaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggaatgtgaccactcccagacagactccctggaggatgaggag
attgaggccttctacaagatgctgacccaccggaaagagatcgacagcacctttgccaag
gccgcgggcgccagggagaccctgtcggtggatcagttagtggcattcttgcagcaccag
cagcgggaggaggcggcagggcctgcactggccctttccctcattgagcgctatgagccc
aatgagactgccaaggctcagcggcagatgaccaaggacggcttcctcatgtacctccta
tcggccgatggcagcgcctttagcctggcgcaccggcgggtctaccaggacatgggccag
ccgctcagtcactacctggtgtcctcctcgcacaacacctacctgctggaagaccagctc
accgggcccagcagcactgaggcctacatacgggcgctgtgcaaaggctgccgctgcctg
gagctcgactgctgggacgggcccaaccaggagccagtcatctaccacggttacactttc
acctccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaaggcg
tccccctaccccgtcatcctgtccctggagaaccactgcagccttgagcagcagcaggtg
atggcacgacacctgcgcaccattctgggacccatgttgttggaccggccgctggacggg
gctaccacaagcctgccttcccctgagcaacttaaggggaagatcttgctgaaggggaag
aagcttggggggctcatgcccgccggaggggaaggcagccctgaggccactgtgtcagat
gaggatgaggctgcggagatggaggatgaggcagtgaggagccgagtgcagcacaaggcc
aaggaggacaagctcaggctagtgaaggagctctccgacatggtcatttactgcaaaagc
gtccactttgggggcttctccagctctggcaccccagggcaggctttctatgagatggcg
tccttctctgagaaccgcgccctccgactcctccaagaatcagggaacagctttgtccgc
cacaacgtgggtcacctgagcaggatctacccagctgggtggagaacggactcctccaac
tacagccccgtggacatgtggaacgggggctgccagatcgtggccctgaacttccagaca
cctgggccagagatggacgtgtaccagggccgcttccaggacaatggggcctgtgggtat
gtgctgaagcctgccttcctacgagaccccaactccaccttcaactcatgtgccctggct
cagggcccctggtggactcagaagaagctcagtgtcacggtcatctcagggcagcagttg
ccaaaagtcaataagaataaaaattcgattgtggaccccaaggtgacagtggagattcat
ggtgtgggcaaagacacagccagccgccagacccccgtagtcaccaataatggtttcaac
ccgtggtgggacacggagtttgagtttgaggtggttgtgcctgagcttgcccttgtgcgc
tttgtggtagaggattatgatgcctcctccaagaatgacttcattggccagagcaccatc
cctctgagcagtctcaagcagggataccgtcacgtccacctcttgtccaagaatggagac
cagcacccatctgccaccctctttgtgaaggtgtccctccaggactag

DBGET integrated database retrieval system