KEGG   Equus caballus (horse): 100054283Help
Entry
100054283         CDS       T01058                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ecb  Equus caballus (horse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100054283 (AGMAT)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100054283 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 364 aa AA seqDB search
MLRLLGAGCAWGLEAGGGVRGLLSGHLGHGVRPATALFDPGHSPSRRASDGPWNQPPSSE
FVARPVGVCSMMRLPVQASPEGLDAAFVGVPLDIGTSNRPGARFGPRRIREESVLLRTAN
PSTGALPFQSLMVADLGDVNVNLYNLQDSCRLIQEAYQRIIAAGCIPLTLGGDHTITYPI
LQAMAKKHGPVGLLHVDAHTDTADKALGEKLYHGTPFRRCMDEGLLDCKRVVQIGIRGSS
MTLDPYTYSRSKGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPMYISFDIDSLDPAYAPGT
GTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALLAANLLFEMLCVLPK
VTTV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgctgggggccggctgcgcctggggtctggaggccggtgggggcgtgcgg
gggctgctctcgggccacttggggcacggcgtgcgtcctgccacagcactcttcgaccct
ggccacagccccagccgccgggcctctgatggcccctggaaccagccccctagctctgag
ttcgtggcccggccggtgggtgtctgctccatgatgcggctgcctgtgcaggcctccccc
gaggggctggacgctgccttcgtcggggtgcccctggacattgggacctccaaccggccc
ggagcgagatttggaccccgacggatccgggaggaatcagtgttgcttcgaacagccaac
ccgagcacgggggccctccccttccagtccctcatggttgcagacctaggagatgtgaat
gtcaatctttacaaccttcaggacagctgccgcctaattcaagaggcctatcagagaatt
atagccgctggctgtattcctctgaccttgggtggagatcacacaatcacatatcctata
ttgcaagcgatggcaaaaaagcatggccctgtggggctgctccatgtggacgctcacacg
gacacggctgacaaggccctaggagagaagctttatcacgggacacccttccgccggtgt
atggacgaaggactcctggattgtaagcgcgtggtgcagatcggcatccggggctcttcc
atgaccttggatccctacacttacagccggagcaagggcttccgggtggtcctggcagaa
gactgctggatgaagtcgctggttcctctgatgggggaagtgaggcagcagatgggaggc
aaacccatgtacatcagcttcgatattgacagcttggatcccgcctatgccccgggcaca
gggacacccgaaattgctggtctcacccctagtcaggctctggagatcatccgcggttgt
caaggcctgaacgtggtgggctgtgatcttgtggaagtttccccgccatacgatccttct
ggaaacacggccctcctggctgctaacctgctgtttgagatgctgtgtgtgctccccaaa
gtgacaactgtctga

DBGET integrated database retrieval system