KEGG   Equus caballus (horse): 100054461Help
Entry
100054461         CDS       T01058                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor isoform X1
  KO
K04135  adrenergic receptor alpha-1A
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04080  Neuroactive ligand-receptor interaction
ecb04152  AMPK signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100054461 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    100054461 (ADRA1A)
   04152 AMPK signaling pathway
    100054461 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100054461 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100054461 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100054461 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    100054461 (ADRA1A)
G protein-coupled receptors [BR:ecb04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100054461 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100054461
NCBI-ProteinID: XP_001494636
Ensembl: ENSECAG00000015917
UniProt: F6UTQ3
Position
2
AA seq 465 aa AA seqDB search
MVFLSGNASDSSNCTHPPAPVNVSKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYVVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APVGGSGVSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDF
KPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSQHALGYALH
PPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSLPRGSARITVPKDRSACTT
ARVRSKSFLQVCCCLGPSTPSLGESHQVPTIKIHTISLSENGEEV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcttcagacagttccaactgcacccacccgccggctcca
gtgaatgtttccaaggccattctgctcggagtaatcttggggggcctcatcattttcggg
gtactggggaacatcctagtgatcctctccgtggcctgccaccgccatctgcactcggtc
actcactactacgttgtcaacctggcggtggccgaccttctgcttacctccacggtgctg
cccttctccgctatcttcgagatcttaggctactgggcctttggcagggtcttctgcaat
atctgggcggcggtggacgtcttgtgctgcaccgcgtccatcatgggactctgcatcatc
tccatcgaccgctacatcggcgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggactcatggctctgctctgcgtgtgggcgctctccctcgtcatctccatcggg
cctctgttcggctggaggcagccagcccccgaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggcgctgggctctttctacgtgccgctggccatcatc
ctggtcatgtactgccgggtctacgtggtggccaagagggagagccggggcctcaagtcg
ggcctcaagactgacaagtcggactcggagcaggtgacgctccgcattcaccggaaaaat
gccccggtaggaggcagcggggtcagcgccaagaacaagacgcatttctccgtgaggctc
ctcaagttttcccgggagaagaaagcagccaaaacactgggcatcgtggtcggctgcttc
gtcctctgctggctgccttttttcttggtgatgcccattgggtctttcttccctgatttc
aagccctcagaaacagtttttaaaatagtattttggctcggatacctaaacagctgcatc
aaccccattatatacccgtgctccagtcaagagtttaaaaaggcctttcagaatgtcttg
agaatccagtgtctccgcagaaagcagtcttcccaacatgccctgggttatgccctgcac
ccgcccagccatgccctggaggggcagcacaaggacctggtgcggattccggtgggatcg
ggagagaccttctataagatttccaagacggatggggtctgtgaatggaaatttttctct
tctctgccccgtggatctgccaggattacagtgcccaaagaccgatcagcctgcaccaca
gcccgggtgagaagtaaaagctttttgcaggtctgctgctgcttggggccctcaaccccc
agccttggcgagagccatcaagttccaaccattaagatccacaccatctccctcagtgaa
aatggggaggaagtctag

DBGET integrated database retrieval system