KEGG   Equus caballus (horse): 100054488Help
Entry
100054488         CDS       T01058                                 

Gene name
USP18
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100054488 (USP18)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100054488 (USP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 374 aa AA seqDB search
MGKVFGVPEDTCWSVLAESQHCAAEAVEKKAEDSNMKKKRERLREWFSAWDCPHGPVGLH
NIGQTCCLNSLLQVLIMNVGFTKILKRITVPRGAEEQRRSVPFQLLLLLEKMQDSRQKAV
QPMELAYCLQKYKVPLFVQHDAAQLYLTVWNLIRDQITDVDLVQRLQALYTIQMKESLVC
LDCTLESSRNSSMLTLPLSLFDMDSKPLKTLEDALRCFFQPRELSNKSKFFCEHCGKKTC
RKQVLQLTHLPQTLTVHLMRFSIRNMKTEKVCHSFYFPQSLDLNQVLLTEQDLCDAEEQP
GGQYELFAVIAHVGMAGFGHYCAYIRNSVDGKWFCFNDSNVCRVSWEDIQCTYGNDNYRW
GEIAYLLVYMKIES
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtgtttggggttcctgaagatacttgctggtcagtcctggctgaatctcag
cattgtgcggcagaagccgttgagaagaaggcagaagacagcaacatgaagaagaagcgg
gagcggctaagagaatggttcagtgcctgggactgccctcatggcccggttggtttacac
aacattggacagacctgctgccttaactccctgcttcaggtattgatcatgaacgtgggc
ttcaccaagatattgaagcggataacagtgccaaggggagcagaagagcagaggaggagc
gtccccttccagctgctcttgttgctggagaagatgcaggacagccgacagaaagcagtg
caacccatggagctcgcctactgtctccagaagtacaaagtacccttgtttgtccagcat
gatgctgctcaactctacctcacagtctggaacctgattagggaccaaatcactgatgtc
gacttggtacagaggctgcaggccctgtatacaatccagatgaaggagtccttggtttgc
ctcgactgtaccctggagagtagcagaaacagtagcatgctgaccctccccctttctctt
tttgatatggactcaaagcccttgaagacactggaggatgcgcttcgctgtttcttccag
cccagggagttgtcaaacaaaagcaagttcttctgtgagcactgtgggaagaagacctgt
aggaaacaggtcttgcaactgacccatttgccccagaccttgacagttcacctcatgcgg
ttctctatcaggaatatgaagacagaaaaagtctgccactcattctatttcccccagagc
ctggatttaaatcaggtcctgctgactgagcaagacctctgcgatgctgaggaacagcct
ggaggacagtatgaactctttgctgtgattgcccatgtggggatggctggctttggtcat
tactgtgcctatatccggaattctgtggatggaaaatggttctgcttcaatgactccaat
gtttgtagggtatcttgggaagacatccagtgtacctatggaaatgataactaccgctgg
ggggaaattgcatatcttctagtttacatgaagattgagtcctaa

DBGET integrated database retrieval system