KEGG   Equus caballus (horse): 100054680Help
Entry
100054680         CDS       T01058                                 

Gene name
ELP3
Definition
(RefSeq) elongator complex protein 3 isoform X1
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100054680 (ELP3)
Transfer RNA biogenesis [BR:ecb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100054680 (ELP3)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100054680 (ELP3)
   HAT complexes
    Elongator complex
     100054680 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 100054680
NCBI-ProteinID: XP_001495637
Ensembl: ENSECAG00000014859
UniProt: F7DT07
Position
2
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKTLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccctgctgagctaatgatgctgaccatagga
gatgttattaaacaactaattgaagcacacgaacaggggaaagacatcgatctaaacaag
gtgaaaaccaagacagctgccaaatatggcctttcagcacagcctcgcctggtggatatc
attgctgcagtcccacctcagtatcgaaaggtcttggtccccaagttaaaggcaaaacct
atcagaactgccagtgggattgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagctttacaggaaatatatgtgtatactgtcctggtggacctgattcagatttt
gaatattcgacccagtcttatactggatatgagccaacctccatgcgagctattcgtgct
agatatgacccttatctacagacaagacaccgaatagaacagttaaaacagcttggtcac
agtgtggataaagtggagtttattgtgatgggtggaacatttatggcccttccagaagaa
tacagagactattttattcgaaatttacatgatgccttatcaggacatacctccaacaat
atttatgaggcagtcaaatattctgagagaagcctcacaaagtgtatcggaattactatt
gagaccagaccagattattgcatgaagcggcatttaagtgacatgttgacctatggctgc
acacggctggagattggggtgcagagtgtctacgaagatgtggccagagataccaacagg
ggccacactgtgaaggcagtatgtgagtcatttcacctagccaaagattctggtttcaaa
gttgtggctcatatgatgcctgatctgccaaatgtggggctagagagagacatcgaacag
tttatagagttttttgagaaccctgcttttcgtcctgatggtttgaaactgtaccctacc
ctggtgattcgtggaacggggctttatgagctttggaaatcaggaagatacaagagttat
tctcctagtgacttgatcgagttggtggctcggatccttgcccttgtgcctccatggact
cgagtgtaccgagtgcagagagacattccaatgcccttagtcagctctggagtagagcat
ggtaatttgagagagctcgcatttgcaagaatgaaagaccttggaatacagtgtcgagat
gtgagaaccagagaggttggaatccaagaaattcatcacaaagtgcggccataccaggtt
gaattggtaaggagagattatgttgcaaatggtggctgggaaacattcttgtcgtatgaa
gacccagatcaagacattttgattggcctcctgcgattacgaaagtgctcagaggaaacc
ttccgttttgaattggttggaggtgtttccatagtccgagagctgcatgtatatggaagt
gtcgtccctgtgagcagtcgagatcctactaaattccagcatcagggatttggcatgctg
ctgatggaggaagcagaaagaattgctagagaagaacatggatctgggaaaatagctgtt
atatcaggggtcggcaccaggaattattacagaaagattggttacagattacaaggcccg
tacatggtaaagacgctaaagtaa

DBGET integrated database retrieval system