KEGG   Equus caballus (horse): 100054701Help
Entry
100054701         CDS       T01058                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04310  Wnt signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04650  Natural killer cell mediated cytotoxicity
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05231  Choline metabolism in cancer
ecb05416  Viral myocarditis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100054701 (RAC2)
   04015 Rap1 signaling pathway
    100054701 (RAC2)
   04010 MAPK signaling pathway
    100054701 (RAC2)
   04310 Wnt signaling pathway
    100054701 (RAC2)
   04370 VEGF signaling pathway
    100054701 (RAC2)
   04071 Sphingolipid signaling pathway
    100054701 (RAC2)
   04024 cAMP signaling pathway
    100054701 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100054701 (RAC2)
   04520 Adherens junction
    100054701 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100054701 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100054701 (RAC2)
   04662 B cell receptor signaling pathway
    100054701 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100054701 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100054701 (RAC2)
   04670 Leukocyte transendothelial migration
    100054701 (RAC2)
   04062 Chemokine signaling pathway
    100054701 (RAC2)
  Development
   04360 Axon guidance
    100054701 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100054701 (RAC2)
   05231 Choline metabolism in cancer
    100054701 (RAC2)
   05210 Colorectal cancer
    100054701 (RAC2)
   05212 Pancreatic cancer
    100054701 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100054701 (RAC2)
   05416 Viral myocarditis
    100054701 (RAC2)
GTP-binding proteins [BR:ecb04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100054701 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 100054701
NCBI-ProteinID: XP_001500843
Ensembl: ENSECAG00000022570
UniProt: F7AX30
Position
28
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRTQKRPCSIL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaagacctgcctcctg
atcagctataccaccaacgccttcccgggagagtacatccccaccgtgttcgacaactac
tcggccaacgtgatggtggacagcaagccagtgaacctggggctgtgggacacagccggg
caggaagactacgaccgcctgcggccgctctcctacccacagacggacgtcttcctcatc
tgcttctccctcgtcagccccgcctcctatgagaatgtccgagccaagtggtaccccgag
gtgcggcaccactgccccagcacacccatcatcctggtgggtaccaagctggacctgcgg
gacgacaaggacaccatcgagaagctgaaagagaagaagctggcgcctatcacctacccg
cagggcctggctctggccaaggagatcgactccgtgaaatacctggagtgctcagccctc
acccagcgaggcctgaaaaccgtctttgatgaggcgatccgggccgtgctgtgcccccag
cccacgcggacgcagaagcgcccctgcagcatcctctag

DBGET integrated database retrieval system