KEGG   Equus caballus (horse): 100054704Help
Entry
100054704         CDS       T01058                                 

Gene name
DCK
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
ecb  Equus caballus (horse)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100054704 (DCK)
   00240 Pyrimidine metabolism
    100054704 (DCK)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100054704 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 263 aa AA seqDB search
MATPPKKSCLSPTTGPQRTRIKKVSIEGNIAAGKSTFVNILKQVCEDWEVVPEPVTRWCN
VQSTQDEFEELTTVEKTGGNVLQMMYEKPERWSFTFQLYACLSRIRAQFASLNGKLKNAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNKQMGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQDIPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYDSLVEKVKEFLNTLSSC
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccacccaagaagagctgcttgtctcccacgaccggccctcagaggacccgc
atcaagaaagtctccatcgaagggaacatcgctgcagggaagtcaacttttgtgaatatt
cttaaacaagtctgtgaggattgggaagtggttcctgagcctgttaccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaattgacaacagttgagaaaactggcgggaat
gttctgcagatgatgtatgagaaacccgaacgatggtcttttaccttccagttatatgcc
tgcctcagtcgaatacgagctcagtttgcctctctcaatggcaagctcaaaaatgcggag
aaacctgtattattttttgagcgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaacagatgggccaaagccttgaactggatggaatcatttatcttcgagct
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaagatatt
cctcttgaatatttagagaagcttcactctaagcatgaaagctggctcctgcatagaaca
ctgaagaccaattttgattatctacaagaagtgcctattttaacactggatgttaatgaa
gactttaaagacaaatatgacagtctggttgaaaaggtcaaagaatttctgaacactttg
tcatcttgctga

DBGET integrated database retrieval system