KEGG   Equus caballus (horse): 100054917Help
Entry
100054917         CDS       T01058                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
ecb  Equus caballus (horse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100054917 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 2216 aa AA seqDB search
MVANLFKNLILPYIHKLCKGMFTKKLGNTTKKKENRQQKRDQDVSTAGQTKTPKLSNTLK
STVKKIAKCSSARNLSTEDDEANKEFSLSPTFSYRVAIANGLQKKINVSNNDNEDLPQEL
SSIESSYSESLNELRSSTENQAQLTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARNPKANALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYIESVVYQILIDKMGFSDAPNTIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSILKKSYKLKGTGIGVSTDILTHDIRERRERG
IPSSQTYESMDIKLTTPEPKIKNNWQSPDDSDGELESDLNRNSYAVLSKSEFPTRGSTSK
SSSKSHNTRAKNKTASSSRISNKSDYDKISSQLPESDNLERQTTTHYADAMPLWHSQSDF
FTSKLSRSESDFSKLCQSYSEDFSESQFFTRTNGSSLLSSSDRELWQRKQEGTPTLYDSP
QDQHLNGVVQVVQGQSKTANTETVDSGMSSGMVCASGDQSHYSDSQLSLREDLSPWKEWN
QVEQGTDVGLDSSTQEAFDYDTNSLSDQQLDVYNKDLEDLAKYHSDLQDDSESYDLTQDD
NSSPCPGLDNEPQGQWAGQYDSYREANSNELYQNQNQLSMIYRSQSEFQSDDSEDAPPKS
WHSRLSIDLSDKAFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQ
STANESSTTLDSDVYTEPYYYKAEDEEDYSEPVADNETDYVEVMEQVLAKLENRTSITET
DEQMQEYDHPSYETPYETPQDEGYDGQADDVASEGGLELLNEIPPEMEVKEDENQNIPEQ
PVEITKPKRIRPSFKEAALKAYKKQMAELEEKILAGDSSSVDEKARIVGGNDLDASKFSA
LQAFGGAGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKI
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEK
CQDLLNADCLQRAAEKSSRHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKE
DFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
SNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
ENFPASNAERLQDLKSTVDLLTSITFFRMKVLELPSPPKASLVVKDCVRACLDSTYKYIF
DNCHELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFP
QELNMGKVSAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAF
KDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFA
QLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCILM
NNIQQLRVQLEKMFESMGGKELDPEASTILKELQVKLNGVLDELSVTYGESFQLIIEECI
KQMSFELNQMRTNGNTASNKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKE
LWKIVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDVKGLTPRQCTIM
EVVLATTKQYFHAGGSGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRS
SKDSVGQISVHVDITPTPGTGEHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKK
RKQGTKTKSNTWSPKYNETFQFILGNGNRPGAYELHLSVKDYCFAREDRIIGMTVIQLQN
IAEKGSHGAWYPLLKNVSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSAEESA
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatcttttcaagaacctgattttaccttacatacataagctttgcaaaggg
atgtttacaaagaaattgggaaatacaaccaaaaaaaaagagaatcgtcagcagaaaagg
gatcaagacgtttctactgctggccagaccaaaacccccaaactttctaataccttgaaa
agcactgtaaagaagattgcaaagtgttcatctgctcgcaacttatccactgaagacgac
gaggctaacaaagaattttccctctcaccaacattcagttatcgagtggctattgccaat
ggactgcaaaaaaaaattaatgtgagcaacaatgataatgaggatctgcctcaagagtta
tcttcaattgagagttcctactcagaatcactcaatgaactaaggagtagtacagaaaac
caggcgcaattaacacacacgatgccagttagacgcaatagaaagagttcaagcagcctg
gcaccctctgagggcagctctgatggggaacgcactctacatagcttaaaactaggagct
ttacgcaaactgaggaaatggaaaaagagtcaagagtgtgtctcttcagattcagaattg
agcacaatgaagaaaacctggggaataagaagcaaatctttggaccgaactgcccgaaac
ccaaaggcaaatgccctggagccaggattcagttcctctggttgtattagccaaacacat
gatgtcatggaaatgatctttaaggagcttcagggaataagtcagatcgaaacagaactt
tctgaactacgagggcatgtcaatgctctcaagcattccatcgatgagatctccagcagt
gtagaagttgtacaaagtgaaattgaacagctacgtacagggtttgtccagtctcggagg
gaaaccagagacatccatgattatattaaacacttaggtcatatgggtagcaaggccagc
ctgagatttttaaatgtgcctgaagaaagatttgaatacattgaaagtgtggtgtaccaa
attctaatagataaaatgggtttttcagatgcaccaaatactattaaaattgaatttgct
cagaggataggacaccaaagggattgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaaccccacagcaaagggattccattttaaaaaaatcatataaactcaaaggaaca
ggtattggtgtctcaacagatattcttactcatgacatcagagaaaggagagagagaggg
ataccatcctcccaaacatatgagagcatggatataaagctcactactccagagcccaaa
atcaagaacaattggcaatcacccgatgacagtgatggagagctggaatctgatctcaat
agaaacagttatgcagtgctttctaagtcagagtttccaacaaggggaagtacttccaag
tcaagttcaaaatcacacaatactagagccaagaataaaactgctagtagcagcagaatt
tcaaataaatcagattatgataaaatttcttcacaattgccagaatcggataacttggaa
cgacaaaccacaacccattatgcagatgcaatgcccctctggcattcacagagtgatttt
ttcacttctaaacttagtcgttctgaatcagatttttccaaattgtgtcaatcttactcg
gaagatttttcagaaagccagtttttcaccaggactaatggaagctccctcctgtcatct
tcagaccgggaactttggcagaggaaacaagagggcacacctaccttgtatgacagtcct
caggatcaacatttgaatggggttgttcaagttgtccaagggcagagtaaaactgctaac
acagaaactgtggatagcggaatgagtagtggcatggtatgtgcatctggagaccaaagt
cattacagtgattctcagctctctttacgtgaggatctttctccatggaaggaatggaat
caagtagagcaaggaactgacgtaggtttagattcatccacccaggaagcttttgactat
gacacaaacagtctatctgatcaacaactagatgtttataataaagacctagaagactta
gcaaagtaccacagtgaccttcaggatgactctgagagctatgatttaacccaagatgac
aactcatctccatgccctgggttggataatgaaccacaaggccaatgggctggccaatat
gattcttaccgggaagctaattctaatgagctgtaccaaaatcaaaaccaattgtctatg
atatatcgaagtcaaagtgaatttcaaagtgatgattcagaggatgccccacccaaatcc
tggcatagtcgattaagcattgacctttctgataaggctttcagcttcccaaaatttgga
tctacactacagagggctaaatcagccttggaagtagtatggaacaaaagcacacagagt
cttagtggatatgaggacagtggctcttccttaatggggagatttcggacattatcccaa
tcaactgcaaatgaatcaagtaccacccttgactctgatgtctacacagagccttattac
tacaaagcagaggatgaggaagattatagtgaaccagtggctgataacgaaacagattat
gttgaagtgatggaacaagtccttgctaagctagaaaacaggactagtattactgaaaca
gatgaacaaatgcaggaatacgatcacccttcatatgaaacaccttatgaaaccccacaa
gatgagggttatgatggacaggcagatgatgtggctagtgaagggggattggaactctta
aatgagataccacctgaaatggaagtaaaagaagatgaaaaccaaaacatccctgaacag
ccagtggaaatcacaaagccaaagagaatccgtccctctttcaaagaagcagctttaaaa
gcctataagaagcaaatggcagaattggaagagaagatcctggctggagatagcagttct
gtggatgaaaaggctcgaatagtaggtggcaatgatttggatgcttccaaattctctgca
cttcaggcatttggtggggctgggcggggactttacgggattgacagtatgccagatctc
cgcaggaaaaagactttgcctattgtacgagatgtggccatgactctggctgcccggaaa
tctggactctccctggctatggtgattaggacatcactaaacaatgaggaactgaaaata
catgtcttcaagaagaccttgcaggctttgatctaccccatgtcctccaccaccccacac
aattttgaggtctggacagctacaacacctacctactgttacgagtgtgaagggctcctg
tggggcattgcccggcaaggcatgaagtgtttggagtgtggagtgaagtgccatgaaaag
tgccaggatctcctaaatgctgactgtttgcagagagcagcagaaaagagttctaggcat
ggtgccgaagacaagactcagaccattattacagctatgaaagaaagaatgaagatcagg
gagaaaaacagaccagaggtgtttgaagtaattcaggaaatgtttcaaatttctaaagaa
gattttgtgcagtacacaaaggcggccaaacagagtgtactggatgggacatctaaatgg
tcagcaaaaataactattacagtggtttctgcacaaggcttgcaggcaaaagacaaaaca
gggtcaagtgacccctatgtgacagttcaagttggaaagaacaaaagaaggactaaaacc
atttttggaaacttaaatccagtatgggatgagaagttttattttgagtgccataactcc
acagatcgaatcaaagtcagagtctgggatgaagatgatgacattaaatccagagtcaag
caacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtcaggacc
ctgagtggagaaatggatgtctggtacaacttagagaaacggacagataagtcagctgta
tctggggccattcgattgaaaatcaatgtggaaataaaaggagaggagaaagttgctcca
tatcatatacaatatacatgtttacatgagaatctgttccattacttgactgaagtgaaa
tctaatggtggagtgaaaatcccagaggtcaaaggggatgaagcctggaaagttttcttt
gatgatgcttctcaagaaatagttgatgaatttgccatgcgttatgggattgagtccatt
tatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccctggtgtccct
gccgtcatgagcaccttgctggcgaatataaacgctttctatgctcacacaacagtttca
acaaatgtacaagtttctgcctcagatcgatttgccgctaccaactttggtagggaaaaa
ttcataaaactactggaccagttgcataactctttaaggattgacctgtcaaagtacagg
gaaaattttcctgccagcaatgctgaaagactgcaagacttgaaatcaacggttgacctg
ctaacaagtatcaccttttttaggatgaaggttttagagctgccaagtcccccaaaggcc
agcttggtggtgaaggactgtgtcagggcttgcctggattccacgtacaagtatattttc
gacaattgccatgaactctattcccagctaatagacccgagtaagaaacaggacattcct
cgggaagatcagggaccaaccaccaagaatttggatttttggccccaacttattacactg
atggtcactattattgatgaggataaaactgcctacacacctgtgctgaatcagtttcct
caagaactgaacatgggaaaagtcagtgctgaaattatgtggaccctttttgctcaggat
atgaaatatgcactagaagaacatgaaaagcagcggttatgcaagagcaccgattatatg
aatttgcatttcaaagtgaaatggttttataatgaatatgtgcgagaacttcctgccttc
aaggatgctgttcctgaatactccttgtggtttgaaccttttgtcatgcagtggctagat
gaaaatgaagatgtatcaatggagttccttcatggagcactgggaagagacaaaaaagat
ggattccagcagacgtctgatcatgcccttttctcttgttctgtggttgatgtctttgct
cagcttaatcagagctttgagattattaagaaactggaatgtcctaatcctgaagcatta
tctcacttaatgagaagatttgcaaagactatcaacaaagtactgcttcagtatgctgca
attgtatcaagtgatttcagttcatattgtgataaggaaaatgtgccctgtatattgatg
aacaatattcaacaattgcgggtccagctggaaaaaatgtttgagtctatgggaggaaaa
gagctagatcccgaagctagtactattctaaaagaacttcaagttaaacttaatggggtt
ttggatgagctcagcgtcacttatggtgaaagtttccagcttatcattgaagagtgtata
aaacagatgagttttgaactaaatcaaatgagaacaaatggaaataccgcatctaataag
aacagtgcagcaatggatgcagagattgtattaagacctctcatggacttcttggacaaa
acattaagtctctcagcaaaaatctgtgagaaaacagtcctgaagcgagttttgaaagag
ctatggaagatagttcttaacaaaatagaaaaacaaattgttctccctcctctgacagat
caaacaggaccccagatgattttcatcgcagctaaagatcttggacaattatctaaactg
aaggagcacatgattcgagaggatgtgaagggtctgacaccaagacaatgcacaataatg
gaggtggtcctggctaccaccaagcaatactttcatgcaggaggaagtggcctcaagaag
aatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacc
caaactactgatgccttgataaagaaattcatagacacccaaacctcacagagtcgctcc
tccaaagattcagtgggtcagatatctgttcatgtggacatcacccccaccccaggaact
ggagagcataaagtcactgtaaaagtgattgctattaatgacctaaactggcagaccacc
gcaatgtttcgcccctttgtggaagtttgtatactgggacccaaccttggagacaagaag
agaaaacaaggcacaaagacaaaaagcaacacgtggtcaccaaagtacaatgaaacattt
cagtttattctgggtaatggaaaccgcccaggggcctatgaacttcatctctcagttaag
gattactgctttgcccgagaagaccgaattatcggaatgacagtaattcagctacagaac
atagcagaaaagggaagccacggagcatggtatccccttttgaaaaatgtctctatggat
gaaactggtttgactatccttagaatactctctcagaggaccagcgacgatgtggctaaa
gaatttgtaagacttaagtctgaaacaagatctgctgaagagagtgcttga

DBGET integrated database retrieval system