KEGG   Equus caballus (horse): 100054921Help
Entry
100054921         CDS       T01058                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecb  Equus caballus (horse)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100054921 (RBKS)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100054921 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 324 aa AA seqDB search
MAAAGDPGRQWPEEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQ
CVQAARLGAKTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGAASIIVDNEGQ
NIIVIVAGANLLLNTEDLREAANAISRAKVMICQLEVTPATSLEALTMAHSNGVKTLFNP
APAIADLDPRFYTLSDVFCCNETEAEILTGLTVGSPADAGKAALVLVERGCQVVIITLGA
DGCVMLSQTQLVPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIA
AVSVQAAGTQSSYPYKKDLPLHLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggctggggacccaggaaggcagtggccggaggaggaggaggcggcggcggtg
gtggtggtgggctcctgcatgaccgacctggtcagtcttacttctcgtttgccaaaaact
ggagaaaccatccacggacataagttttttatcggctttggagggaaaggtgccaaccag
tgtgtccaagctgctaggcttggagcaaagacgtccatggtgtgcaaggttggcaaagat
tcttttggcaacgattatatagaaaacttaaaacagaatgatatttctacagaatttaca
tatcaaactaaagatgctgcaacaggagctgcttcaataattgtcgataatgaaggccag
aatatcatcgttattgtggctggagcaaatttacttttgaatactgaagacctgagggaa
gcagccaatgccattagcagagccaaagtcatgatctgccagctagaagtaactccagca
acttctttggaagccctgacaatggcccacagcaatggagtgaaaacattgttcaatcca
gcacctgccattgcagacctggacccccggttctacacgctctcagatgtgttctgctgc
aatgagactgaggctgagattctaactggcctcacagtcggcagccctgcggatgctggg
aaggctgcactggtgcttgtggaaaggggctgccaggtcgtaatcatcactttgggtgcc
gacggatgtgtgatgctgtcacagacacaacttgtcccaaagcacattcccacagagaaa
gtcaaggctgtggataccacgggtgctggtgacagttttgtgggagctttggccttctac
ctggcttactacccaaatctgtccttggaagaaatgctcaagagatccaatttcatcgca
gcggtcagcgtccaggctgcagggacacagtcatcttatccatacaaaaaagacctgcca
cttcatctgttctga

DBGET integrated database retrieval system