KEGG   Equus caballus (horse): 100055156Help
Entry
100055156         CDS       T01058                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100055156 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 152 aa AA seqDB search
MGLGMKAAGILALIGCLVAVTEPKVYTRCKLAKIFSRAGLDNYRGFSLGNWICMAYYESH
YNTTAQTVLEDGSTDYGIFQINSFTWCRSAKLQDKNHCHVACSALLTDDLTDAIICAKKI
VKETEGMNYWQGWKKHCEGKDLSEWKKGCEVS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggggatgaaggctgccggcatcttggccctgattggctgcctggtcgcagtc
accgagcccaaagtctacactcgctgtaaactggcaaaaatattttcgagggctggcctg
gacaattaccggggctttagccttggaaactggatctgcatggcatactacgagagccac
tacaacacaacggctcagactgtcctggaggatgggagcactgactatggcatttttcag
ataaacagtttcacgtggtgcagaagtgcgaagctgcaagacaagaaccactgtcatgtt
gcctgctcagccttgctcactgatgacctcacagatgcgattatctgtgccaagaaaatt
gttaaagagacagaagggatgaactactggcaaggctggaagaaacactgtgaaggcaaa
gacttgtctgagtggaaaaagggatgtgaagtttcgtga

DBGET integrated database retrieval system