KEGG   Equus caballus (horse): 100055188Help
Entry
100055188         CDS       T01058                                 

Gene name
P4HB
Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100055188 (P4HB)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100055188 (P4HB)
Chaperones and folding catalysts [BR:ecb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100055188 (P4HB)
Membrane trafficking [BR:ecb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100055188 (P4HB)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100055188 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100055188 (P4HB)
  Exosomal proteins of bladder cancer cells
   100055188 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_8 AhpC-TSA ERp29_N Redoxin HyaE
Motif
Other DBs
NCBI-GeneID: 100055188
NCBI-ProteinID: XP_023507538
Position
11
AA seq 510 aa AA seqDB search
MLRRALLCLALAALVRAGAAAPEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREAEDIVNWLKKRTGPAATTLPDGAAAEALVESSEVTVIGFFKDVESDFAKQFLLAAEA
IDDIPFGITSSSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFVKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
ELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctctgcctggctctggccgcgctggtccgcgcgggcgccgcc
gcccccgaggaggaggaccacgtcctggtgctccacaagggcaacttcgaggaggcgctg
gcggcccacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggct
ctggcccccgagtatgccaaagcagctgggaagctgaaggcagaaggttctgagatcaga
ttagcgaaggtagacgccactgaagagtctgatctggcccagcagtatggtgtccgtggc
taccctacgatcaagttcttcaagaacggagacacggcttcccccaaagagtacacagct
ggcagagaagctgaggacatcgtgaactggctgaagaagcgcacaggccctgccgccacc
acgttgcctgacggggccgccgcagaggccttggtggagtccagtgaggtgacggtcatt
ggcttcttcaaggacgtggagtcagactttgccaagcaattcttgctggccgctgaggcc
atcgatgacataccctttgggatcacgtccagtagtgatgtgttctccaagtaccagctg
gacaaggacggggtcgtcctctttaagaagtttgatgagggccggaacaactttgagggg
gagatcaccaaggagaagctgctggacttcgtcaagcacaaccagctgccactggtcatc
gagttcacggagcagacagcccccaagattttcggaggtgaaatcaagacacacatcctg
ctgttcctgccgaagagcgtgtctgactatgacgggaaactgagcaacttcaagaaagcc
gccgagagctttaagggcaagatcctgtttatcttcatcgacagcgaccacaccgacaac
cagcgcatcctcgagtttttcggcctgaagaaggaggagtgccctgccgtgcgcctcatc
accctggaggaggagatgaccaagtacaagccggagtcggacgagctgacagcagagaag
atcacagagttctgccaccgcttcctagagggcaagatcaagccccacctgatgagccag
gagctacctgaggactgggacaaacagcctgtcaaagtgctggtcgggaagaactttgaa
gaggttgcttttgatgagaaaaagaatgtctttgtggaattctacgccccgtggtgcggt
cactgcaaacagttagctcccatttgggataagctgggagagacgtacaaggaccatgaa
aatatcgtcatcgccaagatggactcgacggccaacgaggtggaggcggtcaaagtgcac
agcttccccacactcaagttcttccctgccagcgcggacaggacggtcatcgattacaac
ggggagcggacgctagacggctttaagaagttcctggagagcggtggccaggacggggca
ggggatgacgacgatctagaagatctagaagaagccgaagagcccgacctcgaggaagat
gatgatcaaaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system