KEGG   Equus caballus (horse): 100055188Help
Entry
100055188         CDS       T01058                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100055188 (P4HB)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100055188 (P4HB)
Chaperones and folding catalysts [BR:ecb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100055188 (P4HB)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100055188 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100055188 (P4HB)
  Exosomal proteins of bladder cancer cells
   100055188 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 702 aa AA seqDB search
MRRSGTEGDIPGTCRLEPYMRRAPRAARRAAQPSTAFHLVFGPLRSLRPSSRWRLGSRFS
GLTAVTSARGFTGPSHPASVLAAPRNNPLPGRRRTGLTCAGSCVSSAQEPRWQLATVVCE
ARACAQSQGEGGVGPEVYCPIAGRATRGAAPRDAAQWDGGLKSLSSCAAGDRAGWGLVLA
CHSWPLSRCCPRAPTCQPSPVLAGGYLGEQIRLLWREVLKEKGREVVRLGRVLLSESCFL
FSDAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFK
NGDTASPKEYTAGREAEDIVNWLKKRTGPAATTLPDGAAAEALVESSEVTVIGFFKDVES
DFAKQFLLAAEAIDDIPFGITSSSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLL
DFVKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAESFKGKI
LFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRF
LEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPI
WDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGF
KKFLESGGQDGAGDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcagtgggacggagggagatatccccgggacgtgtcgcctggaaccttacatg
cggcgggcgccgagggctgcccggcgggccgctcagcccagcacagcgttccaccttgtt
ttcggaccccttcggtccctccgccccagctcccgctggagactgggctctcggttctcg
ggcctgactgcagtgacctccgcccgcggcttcacgggcccatcgcatccggcctcggtc
ctcgccgcgccccgcaacaaccccctcccgggcaggaggcgcacgggcctcacgtgcgcc
ggaagttgcgtttcaagtgcccaggagcctcggtggcagctggcgactgtcgtgtgcgag
gcgcgggcctgcgcgcagagccagggggagggcggcgtggggccggaggtctactgcccg
atcgccggacgcgcaactcgaggggcagctccgcgggatgcggcgcagtgggacggagga
ttaaagagtttgtcttcctgtgccgccggtgacagagcagggtgggggttggtgttggct
tgtcattcgtggcctctgtcccgatgttgcccaagagccccgacctgtcagcccagccct
gtgctcgctgggggttatcttggtgagcagataaggcttttgtggagggaagtactgaag
gaaaaaggaagggaagtcgtgagactgggtcgagtgctgctttcagagtcctgctttctt
ttttcagatgccccttggtgtggccactgcaaggctctggcccccgagtatgccaaagca
gctgggaagctgaaggcagaaggttctgagatcagattagcgaaggtagacgccactgaa
gagtctgatctggcccagcagtatggtgtccgtggctaccctacgatcaagttcttcaag
aacggagacacggcttcccccaaagagtacacagctggcagagaagctgaggacatcgtg
aactggctgaagaagcgcacaggccctgccgccaccacgttgcctgacggggccgccgca
gaggccttggtggagtccagtgaggtgacggtcattggcttcttcaaggacgtggagtca
gactttgccaagcaattcttgctggccgctgaggccatcgatgacataccctttgggatc
acgtccagtagtgatgtgttctccaagtaccagctggacaaggacggggtcgtcctcttt
aagaagtttgatgagggccggaacaactttgagggggagatcaccaaggagaagctgctg
gacttcgtcaagcacaaccagctgccactggtcatcgagttcacggagcagacagccccc
aagattttcggaggtgaaatcaagacacacatcctgctgttcctgccgaagagcgtgtct
gactatgacgggaaactgagcaacttcaagaaagccgccgagagctttaagggcaagatc
ctgtttatcttcatcgacagcgaccacaccgacaaccagcgcatcctcgagtttttcggc
ctgaagaaggaggagtgccctgccgtgcgcctcatcaccctggaggaggagatgaccaag
tacaagccggagtcggacgagctgacagcagagaagatcacagagttctgccaccgcttc
ctagagggcaagatcaagccccacctgatgagccaggagctacctgaggactgggacaaa
cagcctgtcaaagtgctggtcgggaagaactttgaagaggttgcttttgatgagaaaaag
aatgtctttgtggaattctacgccccgtggtgcggtcactgcaaacagttagctcccatt
tgggataagctgggagagacgtacaaggaccatgaaaatatcgtcatcgccaagatggac
tcgacggccaacgaggtggaggcggtcaaagtgcacagcttccccacactcaagttcttc
cctgccagcgcggacaggacggtcatcgattacaacggggagcggacgctagacggcttt
aagaagttcctggagagcggtggccaggacggggcaggggatgacgacgatctagaagat
ctagaagaagccgaagagcccgacctcgaggaagatgatgatcaaaaagctgtgaaagat
gaactgtaa

DBGET integrated database retrieval system