KEGG   Equus caballus (horse): 100055240Help
Entry
100055240         CDS       T01058                                 

Gene name
HDAC11
Definition
histone deacetylase 11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 347 aa AA seqDB search
MPHSTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVISFLKEENLLSDSML
VEAREASDEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLKPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIVDL
DAHQGNGHERDFMNDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLGKVER
NLKKALQEHPPDVVVYNAGTDVLEGDRLGGLSISPQGIVKRDELVFRIVRGLQVPILMVT
SGGYQKRTARIIADSILNLCGLGLIGPETPSVSAQNSDSPLLPPEVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccacactcaacccaactgtaccagcatgtgccggagacacgctggcccattgtgtac
tcaccgcgctacaacataaccttcatgggcctggagaaactgcacccctttgacgcggga
aaatggggcaaagtgatcagcttcctaaaagaagagaatcttctgtcagacagcatgctg
gtggaggcacgggaggcctcggacgaggacctgctggtggtgcacacaaggcgctatctg
aacgagctgaagtggtcctttgctgtcgcgaccatcacagaaatcccccctgtcatcttc
ctccccaacttccttgtgcagaggaaggtgctgaagccccttcggacccagacaggagga
accataatggcggggaagctggccgtggagcgaggctgggccatcaacgtgggtggcggc
ttccatcactgctccagcgaccggggcgggggcttctgcgcctatgccgacatcacactc
gccatcaagtttctgtttgagcgagtggagggcatctccagagccaccatcgttgatctg
gatgcccatcagggcaatgggcatgaacgggacttcatgaatgacaagcgcgtgtacatc
atggacgtctacaaccgccacatctaccccggggaccgctttgccaaacaggccatcagg
cggaaggtggagctggagtggggcacggaggatgacgagtacctgggtaaagtggagagg
aacctcaagaaagccctccaggagcatccacccgacgtggtggtgtacaatgcgggcacc
gacgtcctggagggtgaccgccttggggggctgtccatcagcccacagggcatcgtgaag
cgggacgaactggtgttccggattgtccgaggcctccaggtgcccatcctcatggtgacc
tcgggcgggtaccagaagcgcacggcccgcatcatcgcggactctatccttaatctgtgt
ggcctgggcctcatcgggcccgagacacccagcgtctcggcacagaactcagactcgcct
ctgctgccccccgaggtgccctga

DBGET integrated database retrieval system