KEGG   Equus caballus (horse): 100055358Help
Entry
100055358         CDS       T01058                                 

Gene name
LPL
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100055358 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100055358 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100055358 (LPL)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100055358 (LPL)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100055358 (LPL)
  Exosomal proteins of breast milk
   100055358 (LPL)
Heparan sulfate/heparin binding proteins [BR:ecb00536]
 Enzymes (General comment) Variety
  100055358 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 472 aa AA seqDB search
MESKALLLVGLGLWLQSLAAADKIIGGRDFRDIESKFALRTPKDTAEDTCHLIPGVTESV
ANCHFNQSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQHYPVS
AGYTKLVGKDVARFINWMAEEFNYPLDNVHLLGYSLGAHAAGIAGSLTTKKVNRITGLDP
AGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCN
IGEAIRVIAARGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLS
CRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDVHTNQAFEI
SLYGTVAESENIPFTLPEVSINKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSNWWNNP
GFTIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPVVFVKCHDKSLNKKSGW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgctcctggtgggtctgggcttgtggctccagagtctggccgcc
gccgacaaaattataggaggaagagattttagagacatcgaaagtaaattcgctctgagg
acccctaaagacacagctgaggacacttgccacctcattcctggagtgacagaatctgtg
gctaactgtcacttcaaccaaagcagcaaaacctttgtggtgatccacggctggacggtg
acaggaatgtatgagagttgggtgccaaaacttgtggctgctctgtacaagagggaacca
gactccaatgtcattgtggtggactggctgtcacgggcccagcagcattatccagtgtct
gcggggtacaccaagctggtgggaaaggatgtggcccggtttatcaactggatggcggag
gaatttaactatcctctggacaatgtccatctcttgggatacagccttggagcccatgct
gctggcattgcgggaagtctgaccactaagaaggtcaacagaattactggtctagatcca
gctggccccaactttgagtatgcagaagctccaagtcgcctttcccctgatgatgcggat
tttgtagacgtcttacacacattcaccagaggatcacctggccgaagcattgggatccag
aaaccagtagggcatgttgacatttaccctaatggaggcactttccaaccagggtgtaac
attggggaggctattcgtgtgattgcagcgagaggccttggagatgtggaccaactagtg
aagtgctcccacgagcgctccattcatctcttcattgactctctgttgaatgaagaaaat
ccaagtaaggcttaccggtgtaattcaaaggaagcctttgagaaagggctctgcctgagc
tgcagaaagaaccgttgcaacaacttgggctatgagatcaataaggtcagagccaaaaga
agtagcaaaatgtacctgaagactcgttctcagatgccctacaaagtcttccattaccaa
gtaaagatacatttttctgggactgaaagtgatgtacacaccaaccaggccttcgagatc
tctctatacggcactgtggccgagagtgagaacatccctttcacactccctgaagtttcc
ataaataagacatactccttcctgatttacacggaggtggatattggagaactgctaatg
ttgaaactcaaatggaagagcgattcatacttcagctggtcaaactggtggaacaaccct
ggctttactattcagaagatcagagtaaaagcaggagagactcagaaaaaggtgatcttc
tgctccagggagaaggtgtctcatctgcagaaaggaaaggccccggtggtatttgtgaag
tgccatgacaagtctctgaataagaagtccggctggtga

DBGET integrated database retrieval system