KEGG   Equus caballus (horse): 100055358Help
Entry
100055358         CDS       T01058                                 

Gene name
LPL
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ecb00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ecb03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ecb05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 472 aa AA seqDB search
MESKALLLVGLGLWLQSLAAADKIIGGRDFRDIESKFALRTPKDTAEDTCHLIPGVTESV
ANCHFNQSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQHYPVS
AGYTKLVGKDVARFINWMAEEFNYPLDNVHLLGYSLGAHAAGIAGSLTTKKVNRITGLDP
AGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCN
IGEAIRVIAARGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLS
CRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDVHTNQAFEI
SLYGTVAESENIPFTLPEVSINKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSNWWNNP
GFTIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPVVFVKCHDKSLNKKSGW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgctcctggtgggtctgggcttgtggctccagagtctggccgcc
gccgacaaaattataggaggaagagattttagagacatcgaaagtaaattcgctctgagg
acccctaaagacacagctgaggacacttgccacctcattcctggagtgacagaatctgtg
gctaactgtcacttcaaccaaagcagcaaaacctttgtggtgatccacggctggacggtg
acaggaatgtatgagagttgggtgccaaaacttgtggctgctctgtacaagagggaacca
gactccaatgtcattgtggtggactggctgtcacgggcccagcagcattatccagtgtct
gcggggtacaccaagctggtgggaaaggatgtggcccggtttatcaactggatggcggag
gaatttaactatcctctggacaatgtccatctcttgggatacagccttggagcccatgct
gctggcattgcgggaagtctgaccactaagaaggtcaacagaattactggtctagatcca
gctggccccaactttgagtatgcagaagctccaagtcgcctttcccctgatgatgcggat
tttgtagacgtcttacacacattcaccagaggatcacctggccgaagcattgggatccag
aaaccagtagggcatgttgacatttaccctaatggaggcactttccaaccagggtgtaac
attggggaggctattcgtgtgattgcagcgagaggccttggagatgtggaccaactagtg
aagtgctcccacgagcgctccattcatctcttcattgactctctgttgaatgaagaaaat
ccaagtaaggcttaccggtgtaattcaaaggaagcctttgagaaagggctctgcctgagc
tgcagaaagaaccgttgcaacaacttgggctatgagatcaataaggtcagagccaaaaga
agtagcaaaatgtacctgaagactcgttctcagatgccctacaaagtcttccattaccaa
gtaaagatacatttttctgggactgaaagtgatgtacacaccaaccaggccttcgagatc
tctctatacggcactgtggccgagagtgagaacatccctttcacactccctgaagtttcc
ataaataagacatactccttcctgatttacacggaggtggatattggagaactgctaatg
ttgaaactcaaatggaagagcgattcatacttcagctggtcaaactggtggaacaaccct
ggctttactattcagaagatcagagtaaaagcaggagagactcagaaaaaggtgatcttc
tgctccagggagaaggtgtctcatctgcagaaaggaaaggccccggtggtatttgtgaag
tgccatgacaagtctctgaataagaagtccggctggtga

DBGET integrated database retrieval system