KEGG   Equus caballus (horse): 100055407Help
Entry
100055407         CDS       T01058                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100055407 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100055407 (PLCB3)
   04310 Wnt signaling pathway
    100055407 (PLCB3)
   04020 Calcium signaling pathway
    100055407 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100055407 (PLCB3)
   04072 Phospholipase D signaling pathway
    100055407 (PLCB3)
   04071 Sphingolipid signaling pathway
    100055407 (PLCB3)
   04022 cGMP - PKG signaling pathway
    100055407 (PLCB3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100055407 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100055407 (PLCB3)
   04062 Chemokine signaling pathway
    100055407 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    100055407 (PLCB3)
   04922 Glucagon signaling pathway
    100055407 (PLCB3)
   04912 GnRH signaling pathway
    100055407 (PLCB3)
   04915 Estrogen signaling pathway
    100055407 (PLCB3)
   04921 Oxytocin signaling pathway
    100055407 (PLCB3)
   04918 Thyroid hormone synthesis
    100055407 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100055407 (PLCB3)
   04916 Melanogenesis
    100055407 (PLCB3)
   04924 Renin secretion
    100055407 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100055407 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100055407 (PLCB3)
   04270 Vascular smooth muscle contraction
    100055407 (PLCB3)
  Digestive system
   04970 Salivary secretion
    100055407 (PLCB3)
   04971 Gastric acid secretion
    100055407 (PLCB3)
   04972 Pancreatic secretion
    100055407 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100055407 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    100055407 (PLCB3)
   04725 Cholinergic synapse
    100055407 (PLCB3)
   04728 Dopaminergic synapse
    100055407 (PLCB3)
   04726 Serotonergic synapse
    100055407 (PLCB3)
   04720 Long-term potentiation
    100055407 (PLCB3)
   04730 Long-term depression
    100055407 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100055407 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100055407 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    100055407 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100055407 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100055407 (PLCB3)
   05016 Huntington's disease
    100055407 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100055407 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    100055407 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    100055407 (PLCB3)
   05143 African trypanosomiasis
    100055407 (PLCB3)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100055407 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1159 aa AA seqDB search
MAHQLEPCTVVENLRRGSKFIKWDEEASSRNLVTLRVDANGFFLYWTGPNMEVDTLDISS
IRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNFMAVQDDTA
KVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVET
ALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLMD
FINQKQRDPRLNEVLYPPLRHSQARQLIEKYEPNQQFLERDQMSMEGFSRYLGGEENGIL
PLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKG
RPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEY
CRSIFGDALPPVALSSAGSPSSDSCPGLSNGEEVALEKPSLEPQKSLGEEGPQRGPDALG
PVDREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEAARKR
NKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNVGCQL
VALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVANALRVK
VISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPFDFPKVVLPTL
ASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIYTEASDYIPDD
HQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQAGPETCQETQSQQLGSQLTPNPTPS
TLDTSPRRPPGTVTSPTSPSLSSPGQRDDLVASILAEVAPAPLDELRGHKALVKLRSRQE
RDLRELRKKHQRKAVALTRRLLDGLAQARAEGRCRPRPGGLGGEDEKEEEKEVKHYQEFQ
KRQVQSLLELREAQADTESKWRLEHLRQAQQRLREVVLDAHTTQLKRLKETNDREKKELQ
KILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQRQERLVAGQQ
QVLQQLAEEEPKLLAQLAQECQEQRARLPQEVRRSLLGETPEGLGDGHLVACASNGHAPG
SSGHLSGADSESQEENTKL
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccagctggagccgtgtaccgtggtggagaacctgcggcgcgggagtaagttc
atcaaatgggacgaggaggcctccagtcggaacctggtgaccctgcgcgtggacgccaat
ggcttctttttgtactggacaggacccaacatggaagtggacacactggacatcagttcc
atcagggacacgcggacaggccgttacgcccgcctgcccaaggaccccaagatccgggag
gtgctgggctttgggggccccgatgcccggctggaggagaagctgatgacggtggtggcc
gggccagacccggtgaacacgacattcttgaacttcatggccgtgcaggacgacacagcc
aaggtctggtccgaggagctgttcaagctggctatgaacatcctggctcagaatgcctcc
cggaacaccttcttgcgcaaagcatacacgaagctgaagctgcaggtgaaccaggatggg
aggatcccggtgaagaacatcctgaagatgttctcagcagacaagaagcgggtggaaact
gcgctggaatcctgtggcctcaatttcaatcggagcgagtccatccggcccgacgagttt
tccttggaaatcttcgagcggttcctgaacaagctgtgtctgcggccggacattgacaag
atcctgctggagataggcgccaagggcaagccatacctgacgctagagcagctcatggac
ttcatcaaccagaagcagcgggacccgaggctcaacgaggtgctgtacccgcccctgcgg
cactcccaggcgaggcagctcatcgagaagtacgaacccaaccagcagttcctggagcga
gaccagatgtccatggaaggtttcagccgctacctgggaggtgaggagaacggcatcctg
cccctggaggccctggacctgagcgccgacatgacgcagccgctcagtgcttacttcatc
aactcttcccataacacctacctcacggcggggcagctggccgggacctcgtcggtggag
atgtaccggcaggcgctgctgtggggctgccgctgcgtggagctggacgtgtggaagggg
cggccgcccgaggaggagccattcatcacgcacggcttcaccatgaccaccgaggtgccg
ctgcgggacgtgctcgaggccatcgcggagaccgccttcaagacctcgccctaccccgtc
atcctctccttcgagaaccacgtggactcggcaaagcagcaggccaagatggccgagtac
tgccgctccatctttggggacgcgctacctcctgtggccctgtcctcggcagggtccccc
agctccgacagctgccccggcctgagcaacggggaggaggtggccctcgagaagcccagc
ctggagcctcagaagtctctgggggaggaggggccgcagcggggccccgatgctcttgga
cctgttgaccgcgaggatgaggaggaagacgaggaagaggaggaacagacggaccccaaa
aagcccaccacggatgagggcaccgccagcagcgaggtcaatgccacagaggaaatgtcg
accctcgtcaactacatcgagcccgtcaagttcaagtccttcgaggctgcccgaaagagg
aacaagtgcttcgagatgtcgtccttcgtggagaccaaggccatggagcagctgaccaag
agccccatggagttcgtggaatacaacaagcagcagctgagccgtatctaccccaagggc
acccgcgtggactcgtctaactacatgccccagctcttctggaatgtgggctgccagctt
gtcgcgctcaacttccagaccctggatgtggcgatgcagctcaacgcgggcgtgttcgag
tacaacgggcgcagcggctacctgcttaaacccgagttcatgcggcggccggacaagtcc
tttgaccccttcaccgaggtcatcgtggatggcatcgtggccaatgccttgcgggtcaag
gtgatctcggggcagttcctgtccgacaggaaggtgggcatctacgtggaggtggatatg
ttcggcctccctgtggacacgcggcgcaagtaccgcacgcggacctctcaggggaactcg
ttcaaccccgtgtgggatgaggagcccttcgacttccccaaggtggtgctgcccacgctg
gcttcactgcgcatcgcggcttttgaggagggcggcaagttcgtggggcaccggatcctg
cccgtctctgccatccgctcagggtaccactacatctgcctgcggaacgaggccaaccag
ccgctgtgcctgccggccctgctcatctacaccgaggcctccgactacatccctgacgac
caccaggactacgcagaggccctgatcaaccccatcaagcatgtcagcctgatggaccag
agggccaagcagctggctgccctcattggggagagcgaggctcaggctggcccggagaca
tgccaggagacccagtctcagcagctggggtcccagctgaccccaaaccccacacccagc
acactggacacctccccccgccggcccccaggcactgtcacctcccccaccagtccgtcc
ctcagcagcccaggccaacgggatgatctcgtcgccagcatcctcgcagaggtggcccca
gccccactggacgagctccgaggccacaaggctctggtgaagctccggagccggcaggag
cgagacctgcgggagctgcgcaagaagcatcagcggaaggccgtagccctcactcgccgc
ctgctcgacggcctggcccaggctcgggccgagggcaggtgccggccccggccaggtggc
ctaggcggggaggacgagaaggaggaggagaaagaggtgaagcactatcaggagttccag
aaaagacaggtgcagagtctgctggagctgagggaggcccaggccgacacagagagcaag
tggaggctggagcacctgcgacaggctcagcagcggctcagggaggttgtcctggatgca
cacacaacccagttaaagaggctgaaggagacgaacgacagggagaagaaggaactgcag
aagatcctggacaggaagcgccacaacagtatctcggaggccaagacaagggagaaacat
aagaaggaggcggaactgaccgagatcaaccgtcggcacatcactgagtcggtcaactcc
atccgtcggctggaggaggcccagaagcagcggcaggagcgccttgtggccgggcagcag
caggtcctgcagcagctggcagaagaggagcccaagctgctggcccagctggcccaggag
tgtcaggagcagcgggcaaggctgccccaggaggtccgccggagcctgctgggcgagacg
ccggaggggctgggggacgggcatctggtggcctgtgccagcaacggtcacgcgcccggg
agcagcgggcacctgtctggtgctgactcggagagccaagaggagaatacgaagctctga

DBGET integrated database retrieval system