KEGG   Equus caballus (horse): 100055466Help
Entry
100055466         CDS       T01058                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 567 aa AA seqDB search
MKWIKKLGDGVCDTFMMIDETKCPPCSNVLCNPSEPPPPRRPNITAEQLTRDHTQRLLNG
GEMKVEQLFQEFGTRRSATFQSDGISDPEKCSPPVSQGKSSDSLNTVKSSSLSKASKAVP
LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHV
PRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHL
KKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSIQLVRKFAQSIL
QSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEV
ILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPAKLLEQSKRVK
YFINSKGLPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWVTALKGCDDYLFIEFLK
RCLHWDPSARLTPAQALRHPWISKSAPRPPTIEKVSGKRVVNPTNAFQGLGSKLPPVVGI
ANKLKANLMSESHGGIPLCSVLPKLMG
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggataaagaagttgggggatggtgtctgtgataccttcatgatgatagatgaa
accaagtgccccccctgttcgaatgtactctgcaatccctctgagccacctccacccaga
agaccaaatatcaccgctgagcagttaacaagagatcatactcagcgccttctgaatgga
ggtgagatgaaggtagaacagctgtttcaagaatttggcaccaggagatctgctactttc
cagtcagatggcatcagcgaccctgaaaaatgctctcctcccgtgtctcagggtaaaagc
tcagatagtttgaatacggtcaagtccagcagtttgtcgaaagcatcgaaagcggtgcct
ctgactccagaacaggccctgaagcagtataagcaccacctcactgcttatgagaagctg
gagatcatcaattacccagaaatttactttgtgggtccaaatgccaaaaaaagacacgga
gttatcggtggtcccaataatgggggctatgatgatgcagatggggcctatattcatgta
cctcgagaccatctagcttatagatatgaggtgctgaaaattattggcaaggggagtttt
gggcaagtagcccgggtctatgatcacaaacttcgacagtacgtggccctaaagatggtg
cgcaatgaaaagcgcttccatcgtcaagcagctgaggagatccggattttggagcatctt
aaaaaacaggataaaactggtagcatgaacgttatccacatgctggaaagtttcacattc
cggaaccatgtttgtatggcctttgaattgctgagcatagatctctatgagctaattaaa
aaaaacaagtttcagggttttagcatccagctagtacgcaagtttgctcaatccatcttg
caatccttggatgcgctccacaaaaataagatcattcactgtgacctgaagccagagaac
attctcctgaaacaccatgggcgcagcgcgaccaaggtcattgactttgggtccagctgt
ttcgagtaccaaaagctttacacatatatccagtcccgcttctacagagctccagaggtc
attttgggaagccgctacagcacacctattgacatatggagttttggctgcatccttgca
gaactcttaacaggacagcctctcttccccggagaggatgaaggagaccagctggcctgt
atgatggagcttctaggcatgccaccagcaaaacttctggagcagtccaaacgtgtcaag
tacttcattaactccaagggcctacctcgctactgttctgtgactactcaggcagatggg
agggttgtgcttgtggggggtcgctcacgaaggggtaaaaagcgaggtcccccaggcagc
aaagactgggtgacagcactgaaagggtgtgatgactacttgtttatagagtttttgaaa
aggtgtcttcactgggacccctctgcccgcctgaccccagctcaagcgttaagacatcct
tggattagcaagtctgcgcccagacctccgaccattgaaaaggtgtcagggaaacgggta
gtaaatcccacaaatgctttccagggactgggttccaagttgcctccagttgttggaata
gccaataagcttaaagccaacttaatgtcagaaagccatggtggtatacctctgtgcagt
gtactgccaaagctgatgggctag

DBGET integrated database retrieval system