KEGG   Equus caballus (horse): 100055666Help
Entry
100055666         CDS       T01058                                 

Gene name
UNC13B
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
ecb  Equus caballus (horse)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:ecb04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 1844 aa AA seqDB search
MKRLLQESEEEIMVTLGPSSRLSPDKAKAETVCGIKSKSSGPAGSSLEGSSVPPHCGSVA
SATSGDRDGGLAQHCSFGQQASIQPLLGSTACVSESGSEDLSSASITTSCQERSERNQAT
PFLSRGPGQGCSREQREPLGDVVDYIIRELQGISRLQTEIAELQQHLSQVRGSVDEVSSC
VDSVLSEIEGLQVGSSSLAKVCVGGKAQEPHVDRPSEEAILYLYGLPEQDGENTMELVHS
FLAKHLCVNGVQCNRYIREAYRAGKAPAPRPTVVKLAHLEHRDFILQKSILLQSLGIRIA
TREEPSWPQCCKNSQKESLSFLQQLQDHNSNTLNLHEPVLQMETGVMGPKTGAYHMRAQN
QHRESQNLEQQGLCFPPKNNLAKPSDVSQPGDEVKGTPEASRVISGGPSELTGREASLSP
LPQFEEASLVLISKEEDSGKSQVFKQCRQGLEAYEVTKRENCSDKSKASSYLSLSELMNT
EDKLLACEAGLDILSSKQLEDLLTDKSGRFAALSCGSVMEEMIIGPETFRDMVHIDLNEE
EECAAQVLKNVFEKSSCGLSGSQEHEDVEIKFYTSKLGRAIHHFRSALQGVFQKPENSGS
ISPEDLQGNESGSQTENSDRLLVTIPDDGDSSLPQWLPEGPAGGLYGIDSMPDLRRKKPL
PLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTA
TTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQ
NIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSAKITIT
VVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVR
VWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQ
ISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGTGGVWIPEARGDDAWKVYFDETAQEI
VDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASD
RFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRM
KVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYNRQYQLQELPPEEQGPSIRNLD
FWPKLITLVVSIIEEDKNSYTLVLNQFPQELNVGKVSAEVMWQLFAQDMKYALEEHEKDR
LCKSADYMNLHFKVKWLYNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRG
ALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIG
KVLMQYADILSKDFPTYCTKEKMPCILMNNMQQLRVQLEKMFEAMGGKELDPEAADSLKE
LQVKLNTVLDELSMMFGNSFQVRIDECIGQMADILGQVRGPGNASPNTRASAAQDADSVL
RPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLSDHTGTQLIFTAA
KELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQS
LRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQV
DLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNW
APKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDHILGLAVMPLRDVAAKGSCACWCP
LGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRSMEEGS
NT seq 5535 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgttgcaagagtcagaggaagaaatcatggtcaccttgggaccctcctcc
aggctttccccggataaggctaaggcagagactgtgtgtggcatcaagagcaagtcctca
ggccctgctggatcctcactagagggcagttccgtgccccctcactgtggatcagtagcc
tctgccactagtggggatagagacgggggcctagcccagcattgcagctttgggcagcag
gccagcatccagccgcttctgggctccactgcctgtgtttcagagtctggctctgaggac
ctctcatctgctagcattaccacaagctgtcaagagcgctcagagaggaatcaagctact
ccctttttgtccagaggccctgggcaaggctgcagccgtgagcagcgagaacctttggga
gatgtagtagactatattatcagagagctgcaaggcatcagccgtctccaaactgagatt
gccgagctgcagcagcacttgagccaagtccggggttcagtggatgaagtctctagctgt
gtagactcagttctcagtgaaatagaaggcttacaggtgggcagcagctccctggccaag
gtgtgtgtgggtggaaaggcccaggaaccccatgtggaccgacccagtgaggaagccatt
ctgtatctgtatggacttcctgagcaagatggggagaataccatggagctggtacacagc
ttcctggccaagcacctctgtgttaatggcgttcagtgcaacaggtacatcagagaggct
tacagggcaggcaaagccccagcccccaggcctactgttgtgaagcttgcccatctagag
catagagacttcatcttgcagaaatccatccttttgcagagtttaggcatccggattgcc
accagagaagaaccaagctggccacagtgctgtaagaattcccaaaaggagtctctgtca
tttttgcaacaacttcaggatcataattcaaatactttaaacctacatgaaccagtgctt
cagatggaaacaggagtcatgggacccaaaacaggagcatatcacatgagagctcagaat
caacatagagaatcccagaaccttgagcagcaaggcctttgcttcccacccaagaacaat
ttagcaaagccaagtgatgtgtctcagccaggggacgaagtaaaaggaacaccagaagca
tcccgagtcatcagtggtggccctagtgaactgacagggagagaagcttctctgtctcct
ctccctcaatttgaggaagcttccctagtgttaatctcaaaagaggaggattctgggaaa
tcccaggttttcaaacaatgcaggcaaggacttgaagcatatgaagtaacaaaaagagaa
aactgcagcgataagagtaaggccagcagctacctgtcgctgtctgagttgatgaacaca
gaggacaagctcctggcctgtgaagctgggcttgatattctgagctcaaagcagttagag
gacctcttgacagacaagtccggaaggtttgcagctctgagctgtggcagcgtgatggag
gaaatgatcatagggcctgagactttccgtgacatggttcatattgacttgaatgaagag
gaggaatgtgctgctcaggtccttaaaaatgtctttgaaaagtcctcttgtggtctgagt
ggctcacaggagcatgaagacgtagaaattaaattttataccagtaaactgggccgagca
attcaccactttcgttcagctctacagggagtgtttcagaagccggagaacagtggatcg
atcagtcctgaggacctgcaaggcaatgagagtggatcccagacagagaacagtgacaga
cttcttgtgacaattccggatgatggtgactcttctttaccccagtggctcccagaaggg
ccagctggagggctttatggcattgacagcatgccagatctacgcagaaagaagccactg
ccacttgtcagtgatttgtcactggtccagtcccggaaggcagggattacttctgcaatg
gctacacgcacctctctcaaggatgaagagctgaaatcccatgtgtataagaaaaccctg
caagccttaatctaccccatctcgtgtactacacctcacaactttgaggtctggacagcc
actactccgacctactgctatgagtgtgaaggcctgctctggggcatcgcccggcagggc
atgcgctgcagcgagtgtggagtcaagtgccatgagaagtgccaggacctgctcaatgct
gactgcctgcagcgagctgcagaaaagagctctaaacatggagctgaggaccggacccag
aacattatcatggccatgaaggaccgcatgaagatccgagagcggaataagccggagatc
tttgaagttatccgggatgtcttcaccgtgagcaaagttgcccatgtgcagcagatgaaa
acagtgaagcagagtgtgctggatggcacctccaaatggtcagccaagattaccatcact
gtggtttgtgcccagggcctacaagccaaggacaagacaggatccagtgacccttatgtg
actgtgcaagtaggcaaaaccaagaagcgtaccaagacgatttttgggaacctgaatcct
gtttgggaggagaagttccattttgagtgccacaactcttctgaccgcattaaggtacgt
gtgtgggatgaggatgatgacatcaaatcaagagtaaagcagcggctaaagcgagagtct
gatgatttcctcggccaaactatcatcgaggttcggacactaagtggcgaaatggatgtc
tggtacaacttggagaagaggacagacaaatcagccgtctcaggggctatccgactccaa
atcagcgtggagatcaagggggaagagaaagtagccccgtatcatgtgcagtatacgtgt
ctccatgagaaccttttccattacttaacagacattcagggcactggaggagtttggatc
cctgaggctcgaggagacgatgcatggaaggtgtactttgatgaaactgcccaagaaatt
gtggatgaatttgccatgcgctatggcatcgaatccatatatcaagccatgacgcacttt
gcatgtttgtcatccaagtacatgtgtcctggtgtgccagcagtgatgagcaccttactg
gccaacatcaatgcctactatgcccacacaactgcctccaccaatgtctctgcatctgat
cgctttgcagcctccaactttgggaaagagagatttgtaaaattgctggaccagctgcac
aactcactgaggattgacctctctacatacaggaataatttccctgctgggagccctgag
cggcttcaggacttaaagtccacagtggatttgctgaccagtattactttcttcagaatg
aaggtgcaagaactgcagagccctccaagagctagccaggtggtaaaggattgtgtgaag
gcctgtttgaactccacatatgagtatatcttcaacaactgccatgacttgtacaaccgc
cagtaccaactgcaagagctgcctccagaggaacaagggcccagcattcggaacctggat
ttttggcccaaactcatcacacttgttgtgtcaatcatagaggaagataagaattcctac
acactcgttctgaaccagtttcctcaggagttgaatgtgggaaaagtcagcgcagaagtg
atgtggcaactctttgcccaagacatgaaatatgcactggaggagcatgagaaagaccga
ctgtgtaagagtgctgactacatgaacctgcacttcaaggtgaagtggctctacaatgaa
tacgtgcgggatctgcctgcgctccagggacaggtgcctgagtatcctgcgtggtttgag
cagtttgtcctacaatggctggatgagaatgaggatgtgtccctggaattcctgcgtggg
gccctggaacgggataagaaggatgggttccagcagacatcagagcacgcactcttctcc
tgctctgtggtggacgtcttcacacagctcaaccagagctttgagatcatccggaagctg
gaatgcccagaccccaacatccttgcccactacatgaggagatttgctaagaccatcggg
aaggtgctgatgcagtatgcagatatcttatcaaaggacttcccaacttactgcacaaag
gagaaaatgccctgcatcctgatgaacaacatgcagcaactgagggtccagctggagaaa
atgtttgaggccatgggaggcaaagagttggaccctgaagctgcagacagtctgaaggag
ctgcaggtgaaactgaatacagttctggatgagctcagcatgatgtttggaaacagtttc
caggtgcggattgatgagtgtatcggacaaatggccgacatcctgggccaagtgcggggc
ccagggaatgcatcccccaacaccagggcctcagcggctcaggacgcggatagtgtgctg
cggcctctcatggacttcctggatggcaacctcacactctttgccactgtgtgtgagaag
acggttctgaagcgtgtactgaaggagctctggcgggtggtaatgaacacaatggaaagg
atgattgttctgcccccactcagtgaccacacgggcacccagttgatcttcactgctgcc
aaggagctgagccatctttccaaactcaaggaccacatggtgcgagaggaaacacggaat
ctcactccaaagcagtgtgccgtccttgaccttgccctggacaccatcaagcaatacttt
catgcaggaggcaatgggctgaagaaaaccttcctggagaagagcccagatctgcagtcc
cttcgctatgccctgtctctgtatacacagaccacagacacacttatcaagacctttgtg
cgctcacagactgcccaggtgcatgatgggaaaggtattaggtttactgctaatgaggac
attcggccggaaaaggggtctggtgtggatgatcctgtaggagaagtctctattcaggtg
gacttgtttacacatcctggaactggggagcacaaggtcacagtgaaagtggtggctgcc
aatgacctcaagtggcagacagcgggtatgttccgaccctttgtggaagtgaccatggtt
ggcccacaccaaagtgataagaagaggaagttcacaaccaagtcgaaaagcaacaactgg
gccccaaagtacaatgagacgtttcacttcctcctgggaaatgaagaggggccagaagca
tatgagttgcaaatatgtgtgaaggattactgctttgcccgagaggatcacattctgggg
ctggcagtgatgcctctgagggatgtggcagccaagggcagctgcgcctgctggtgcccc
ttgggccggaagatccacatggatgagacaggcctgaccattctccggattttgtctcag
aggagcaatgacgaagtggcccgagagtttgtgaagctcaaatcagagtctcgttccatg
gaggagggaagctga

DBGET integrated database retrieval system