KEGG   Equus caballus (horse): 100055670Help
Entry
100055670         CDS       T01058                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100055670 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100055670 (PLCG2)
   04012 ErbB signaling pathway
    100055670 (PLCG2)
   04370 VEGF signaling pathway
    100055670 (PLCG2)
   04064 NF-kappa B signaling pathway
    100055670 (PLCG2)
   04066 HIF-1 signaling pathway
    100055670 (PLCG2)
   04020 Calcium signaling pathway
    100055670 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100055670 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100055670 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100055670 (PLCG2)
   04662 B cell receptor signaling pathway
    100055670 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100055670 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100055670 (PLCG2)
   04670 Leukocyte transendothelial migration
    100055670 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100055670 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100055670 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100055670 (PLCG2)
  Development
   04380 Osteoclast differentiation
    100055670 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100055670 (PLCG2)
   05206 MicroRNAs in cancer
    100055670 (PLCG2)
   05205 Proteoglycans in cancer
    100055670 (PLCG2)
   05214 Glioma
    100055670 (PLCG2)
   05223 Non-small cell lung cancer
    100055670 (PLCG2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100055670 (PLCG2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100055670 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1265 aa AA seqDB search
MNTMVNVNALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKSSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSREDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEHWAQDLNRVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCGVEQQRHMARV
FKEVFGDQLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTGEEEPPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTEPVPNPNPHEAKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRARGKVKHCRINKDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNQKGLTRIYPKGQRVDSSNYDPFRFWLCGSQMAALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatggtcaatgtgaacgcccttccggaatacgagaagagtcagatcaagagg
gccctggagctgggcacagtgatgaccgtgttcagcttccgcaagtccacgccggagcgc
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagacggccgacaag
atcgagggcttcttggatatcatggaaataaaggaaatccgcccagggaagagctccaag
gattttgagcgtgcgaaagccgtccgccagaaggaagactgctgcttcaccatcttgtac
ggcacccagttcgtcctcagcacactcagtttggcagctgactctagagaagatgcaact
aagtggctgtctggcttgaaaatcttacaccaggaagcgatgagtgcgtccacacccacc
attattgagagttggctgagaaagcagatttattctgtggatcaaaccagaaggaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagtgcc
aagttcctgaaagataagtttgtggaaataggcgcgcacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaagtcgattcttgacgaa
ttcaaaaaggattcttctgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gttcacctgcacgacttccagcggtttctcttacatgaacagcaggaacactgggctcag
gatctgaacagagtccgtgagcggatgacaaagttcatcgacgacacgatgagggaaact
gctgagcccttcttgttcgtcgatgagttcctcacgtacctgttttcacgggagaacagc
atctgggatgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtcacat
tactggatctcctcatcccacaatacgtacctcacaggtgaccagctgcggagcgagtcg
tccacggaagcgtacatccgctgtctgcggatgggctgtcgctgcatcgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgatgtcgtgcaggccatcaaagaccacgcctttgtcacctcgagcttcccc
gtgatcctgtccatcgaggagcactgtggcgtggagcagcagcgccacatggccagggtc
ttcaaggaggtgtttggcgaccagctgctgatgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacatggaggacaagaaggatgaacacaagcaacagggtgaa
ctgtacatgtgggattccattgaccagaaatggactcggcactactgtgccattgctgat
gccaagctgtcctttagcgacgacattgaacagaccggggaagaggagccaccccaggat
acaccccccacagagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acaagtgccgagaagctgctacaggaatactgtgccgagaccgggggcaaggatgggacc
ttcttggtgcgagagagcgagaccttccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcactgccggatccgctccaccatggagggcgggaccatgaagtactac
ctgactgacaacctcatgtttaccagcatctacgccctcatccagcattaccgcgagacg
cacctgcgctgcgccgagttcgagcttcggctcaccgagcccgtgcccaaccccaacccc
cacgaggcaaagccgtggtactacgacgggctgagccgcggagaagcagaggacatgctg
atgagggttccccgggacggggccttcctgatccggaagcgggaaggcacggactcctac
gccatcaccttcagggccaggggcaaagtgaagcactgtcgcatcaacaaggacggccgg
cactttgtgctggggacctccgcctacttcgagagcctcgtggagctcgtcagttactac
gagaagcatgcgctctaccgaaagatgaggctgcgctaccccgtgactcccgagctgctg
gagcgctacaatatggaaagagatataaactccctctatgacgtcagcagaatgtatgtg
gatcccagcgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagtgatgagctgagcttctgccgtggcgccctcatccacaacgtctcc
aaggagcccgggggctggtggaaaggagactatgggaccagaatccagcaatactttccg
tctaattacgtcgaggacatctcaacagctgacgtggaggagctggaaaagcagattatt
gaagacaatcccttagggtctctctgcagaggaatattggatctcaacacctataacgtt
gtgaaagccccacaggggaaaaaccagaagcctttcgtctttatcctggagcccaagaag
cagggcgatcctccggtggagtttgccacggacagggtggaggagctctttgagtggttt
cagagcatccgggagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgatcgccatcgagctctcagacctggtcgtctactgcaagccaacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctcgtttgtggag
acgaaggcggacagtgtggtcagacagaaacccatcgatctcctgaagtacaatcaaaag
ggcctgacccgcatttaccccaagggacagagggtggactcctccaactacgaccccttc
cgcttctggctgtgtggctcccagatggcggcactcaatttccagactgcagataagtac
atgcagatgaaccacgccttgttttcactcaatgggcggacgggctacgtcctacagcct
gagagcatgaggacggagaagtacgaccccatgccgcccgagtcccagaggaagatcctg
atgactttgacggtcaaggttcttggggctcgccatctccccaaacttggacggagtatt
gcatgtccctttgtggaggtggaaatatgtggagccgaatatgacaacaacaagtttaag
acgacagttgtgaatgacaatggcctaagccctgtttgggctccaacacaggagaaggtg
acgtttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtttatgaggaagat
atgttcagtgatcccaactttcttgctcatgccacttaccccattaaagggatcaaatca
ggatttagatctgttcctctgaagaatgggtacagtgaagacattgagctggcttccctc
ctggttttctgtgagatgcggcccgtcctggagagcgaagaggaactctactcctcctgt
cgccagctgcggaggcggcaggaagagctgaacaaccagctctttctgtacgacacacac
cagaacttgcgcaatgccaaccgggatgccctcgttaaagagttcaacgtcaacgagaac
cagctccagctgtaccaggagaagtgcaaccggaggttaagagagaagagagtgagcaac
agcaagttttactcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system