KEGG   Equus caballus (horse): 100055721Help
Entry
100055721         CDS       T01058                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100055721 (USP37)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100055721 (USP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 981 aa AA seqDB search
MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLNAAMKPSQGSGSF
GAILGSRTSQKETNRQLSYSDNQASSKRGSLETKDDIPFRKVLSNPGRGSIKTAAGSGIT
VTRTIPPLTSTSTPLRSGLLENRTEKRKRMLSSGSELNEDYPKENDSSSNNKAMTDPSRK
YLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGGRAGSKDYSSGSTNLDRTNVSSQTPSA
KRSLGFLPQPTPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQS
LFSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATA
ERFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKAEPVPGEENLPDVSVTRVYTCPVITN
LEFEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSC
EKCGGKCALVRHKFNRLPRILILHLKRYSFNVALSLNNKIGQQVVIPRYLTLSSHCTEST
KAPFTLGWSAHTAVSRPLKASQMVNSCITSPSTPSKNFTFKSKSSLALCLDSDSEDELKR
SVALSQRLCEIPGSEQQQEDLEKDSKSCRIEPGKSELENSGFDGMSEEELLAAVLEISKR
ESSPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDPVETEKPKTITEPDPASFTEITKDC
DENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATE
LSLQEFNNSFLDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHI
GSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFNELL
ETEKSAQALGVDAGRAARQAS
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatacatggtcctatcagaattcgaagtatgcagactgggattaca
aaatggaaagaaggatcctttgaaattgtggaaaaagagaataaagtcagcctagtagtt
cactacaatactggaggaattccaaggatatttcagctaagtcataacattaaaaatgtg
gtgcttcgacccagtggagcaaaacaaagccgcctaatgttaactctacaagataacagc
ttcttgtctattgacaaagtgccaagtaaggatgcagaggaaatgagattgtttctagat
gcagtccatcaaaacagacttaatgcagccatgaaaccctctcaggggtctggtagtttt
ggagctattctgggcagcaggacctcacagaaggaaacaaacaggcagctttcttactca
gacaatcaggcctcttcaaaaagaggaagtttggaaactaaagatgatattccatttcga
aaagttctcagtaatccaggtagaggatcgattaagactgcagcaggaagtggaataact
gtcacccggacgattccccctttgacgtctacatcaacacctcttagatcagggttatta
gaaaataggactgaaaagaggaaaagaatgctatcatctggctcagagttgaatgaagat
taccctaaggaaaatgattcatcatcgaacaacaaggctatgacagatccctcaagaaag
tatttaaccagcagtagagagaagcagctgagtttgaaacagtcagaagagaacaggaca
tcaggccttttacctttgcagtcatcatccttttatggtggtagagctggatctaaggac
tactcttctggcagcaccaatctagacaggactaatgtttcaagtcaaactccctctgct
aaaagaagtttgggatttcttcctcagccaactcctctttctgttaaaaaactgagatgt
aaccaggattatactggttggaacaaaccaagagtgcccctttcctctcaccaacagcag
caactgcagggcttctccaatttgggaaatacctgctatatgaatgctattttacagtct
ctattttcactccaatcatttgcaaatgacttgcttaagcaaggtattccatggaagaaa
attccactcaatgcgcttatcagacgctttgcacacttgcttgttaaaaaagatatctgt
aattcagagaccaaaaaagatttactcaagaaggttaaaaatgccatttcagctacagca
gaacgattctctggttatatgcagaatgatgctcatgaatttttaagtcagtgcttagac
cagctgaaagaggatatggaaaaattaaataaaacttggaaggctgaacctgttcctgga
gaagaaaatttgccagatgtttcagtcactagagtatacacttgccctgtcattactaat
ttggagtttgaggttcagcactccatcatctgtaaagcatgtggagagattattcccaaa
agagagcagtttaatgacctctccattgaccttcctcgaaggaaaaagccactccctcct
cgttcaattcaagattctcttgatcttttctttagggcagaagaacttgagtattcctgt
gagaagtgtggtgggaagtgtgctcttgtcaggcacaaatttaacaggctacccaggatc
ctcattcttcatttgaaacgatacagcttcaatgtcgctctgtcacttaacaacaagatt
gggcagcaagtcgtcattccgagatacctgaccctgtcctctcattgcactgaaagtaca
aaagcgcccttcacccttggttggagtgcacacacagcagtttctagaccattgaaagcc
tctcaaatggtgaattcctgcatcaccagcccttctacaccttcaaagaatttcaccttc
aaatccaagagctccttggctttatgccttgattcagacagtgaggatgagctaaaacgc
tccgtggcccttagccagagactttgtgaaataccaggcagtgaacagcagcaggaagac
ctggaaaaagattcaaaatcatgcagaatagagcctggtaagtccgaattggaaaactcc
ggatttgacggaatgagcgaagaagagcttctagcagctgttttagagataagtaagaga
gaatcttcaccatctctgagtcatgaagatgacgataaaccaaccagcagcccagatact
ggatttgcagaagatgatattcaagaaatgcctgaaaatccagaccctgtggaaactgag
aagcctaaaacaatcacagagccggatcctgccagttttactgaaataactaaagactgt
gatgagaataaagaaaataaaactccggaaggatctcaaggagaggttgattggctccag
cagtatgatatggagcgtgaaagggaagagcaagagcttcagcaggcattggctcagagc
ctccaggagcaagaggcttgggaacagaaagaagacgatgacctcaaaagagctacagag
ttaagtcttcaagagtttaacaactcttttctggattcattgggttctgatgaggactct
ggaaatgaggatgttttagatatggagtacacagaggctgaagctgaggaactgaaaaga
aacgctgagacaggaaatcttcctcattcctatcggctcatcagtgttgtcagtcacatt
ggtagcacttcttcttcaggtcattacattagtgatgtgtacgacatcaagaagcaggcg
tggtttacttataatgacctcgaagtgtctaaaatccaggaggcttctgtgcagagtgac
cgagatcggagtggttacatcttcttttatatgcacaaggagatcttcaatgaactgcta
gaaacagaaaagagcgctcaggcgctcggcgtggacgcgggaagggccgctcgccaggcc
tcgtag

DBGET integrated database retrieval system