KEGG   Equus caballus (horse): 100056040Help
Entry
100056040         CDS       T01058                                 

Gene name
CDC42BPG
Definition
CDC42 binding protein kinase gamma (DMPK-like)
Orthology
K16307  
serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1549 aa AA seqDB search
MEQRRRALEELARGEAGGGPGLDGLLDLLLGLHHELSSAPLRRERNVAQFLSWASPFVTK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASARDLIRQLLCHQEERLGRRGLDDFRNHPFFEGVDWERLATSTAPYIPELRGPM
DTSNFDVDDDTLNHPGTLPPPSHGTFSGHHLPFVGFTYTSSSPSPESSSEQVAALEQRLR
CLEQEKTELSRKLQEALQMPSDHRELEQLRKEVQTLQDRLSEMLRESKAPVSQTEGSPGQ
HSDLQQERDRLLQELAEAQTRLQMQEQELGRAQGRQEELLQRLQEAQEREASTASQTQAL
NSQLEEARDARRELQAQVATLSREVRRLQRDQERSLEKEPSQVKTVHTTSETNGTGXPES
RPQEAQLRKEVAALRVQLEQARSHGPSGKEEALCRLQEENRRLSQEQERLVEELERELQS
KQRLEGERQESESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTLPT
RPLDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQERLTQAQEAQLQAESRLQEAEK
QNQSLKQELAALREELRARGPGDTKPSNSLIPFLSFRSSEKDPAKDPGISGEAPRPGSEP
ELRPEGRRSLRLGAVFPRAPAATTAATEGPPAKPGSHTLRPRSFPSPTKCLRCASLMVGL
GRQGLGCDACGYFCHSTCAPQAPPCPVPPDLLHVALGVHPETGTGTAYEGFLSVPRPSGV
RRGWQRVFAALSDSRLLLFDAPDPRLSPASGALLQALDLRDPQFSATPVLASDVIHAQSK
DLPRIFRVTASQLTVPPATCTVLLLAESEGERERWLQVLGELQRLLLDTRPQPRPVYTLK
EAYDNGLPLLPHALCAAIIDQERLALGTEEGLFVIHLHSNDIFQVGECRRVQRLAVSPTA
GLLVVLCGRGPSVRLFALAELESTEVAGAKIPESRGCQVLAAGRILQARTPVLCVAVKRQ
VLCYQLGPGPGPWQHRIRELQAPAPVQSLGLLGDRLCVGAAGAFALYPLLNEAAPLALGA
DLVPEELPPSRGGLGEALGAVELSLNEFLLLFTTAGVYVDGAGRKSRIHELLWPAVPTGW
GYAAPYLTVFSENSIDVFDVRKAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRNRL
AEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQRQQQRREMLKDPFVRSKLISSPTN
FNHLVHMGPMDGKPSARNPPRAPEEKGRGSRSSGPQRPHSFSEASRRPASMGSDGLAGDA
DPMKRKPWTSLSSESVSCPQGSLSPAASLTQVSERPRSLPPAPEPESSP
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggcggcgcgcgctggaggagctggcacggggcgaggccggcggcggcccg
gggctcgacggcctcctggatctgctgctggggctgcaccacgagctcagcagcgccccc
ctgcggcgggagcgcaacgtggcgcagttcctgagctgggccagccccttcgtcacgaag
gtgaaagagctgcggctgcagagagatgactttgagatcttgaaggtgatcggccgaggg
gccttcggggaggtcgccgtggtgaggcagagggacagcgggcagatttttgccatgaaa
atgctgcacaaatgggagatgctgaagagggccgagacagcctgtttccgggaggagcgg
gacgtgctggtgaagggggacagccgctgggtgactgctctgcattacgccttccaagac
gaggagtacctgtacctcgtgatggactactacgctggtggggacctcctcactctgctg
agccgcttcgaggaccgcctcccgcccgagctggcccagttctacctggctgagatggtg
ctggccatccactcactgcaccagctgggctatgtccacagggatgtcaagccggacaat
gtcctgttggatatgaatggacacatccgcctggctgactttggctcctgcctgcgtctc
aacaacagtggcatggtggattcatcggtggcagtggggacccctgactacatctcccct
gagatcctgcaggccatggaggagggcaagggccactacggcccacaatgcgactggtgg
tcgctgggagtctgcgcctacgagctgctctttggggagacgcccttctatgctgaatcc
ctggtggaaacctacggcaagatcatgaaccatgaggaccacctgcagtttcccccggat
gtgcccgacgtgccggccagcgcgagagacctgatccgccagctgctgtgccaccaggag
gagcgactgggccgcagagggctggacgacttccggaaccaccctttcttcgaaggtgtg
gactgggagcggctggcgaccagcactgccccctacatccctgagctccgtgggcccatg
gacacctccaacttcgacgtggatgatgacaccctcaaccatccagggaccctgccacca
ccctcccatgggaccttctccggccaccacctgccatttgtgggcttcacctacacctcg
agcagtcccagccctgagagcagctccgagcaggtggctgccctggagcagaggctccgt
tgtctggagcaggagaagacggagctgagccggaagctccaagaggccctgcagatgccc
tcggaccaccgggagctggagcagctgcggaaggaggtgcagactctacaggacaggctg
tcagagatgctgagggaaagcaaggcccccgtgtctcagacggagggtagcccaggccag
cacagtgaccttcagcaggagagagaccggctcctccaggagctggccgaggctcagaca
aggctgcagatgcaggagcaggagctgggcagagcccaagggcggcaggaggagctgctc
cagaggctgcaggaagcccaggagagagaggcatccacagccagccagacccaggccctg
aactcccagctggaggaggcccgggatgcccggagggagctgcaggcccaggtggccacc
ctgagccgggaggtgaggcggctccagagagatcaggagcgaagccttgagaaggagcca
tcccaggtcaagaccgtccacaccacctccgagaccaacggcacgggctagcccgaaagc
aggcctcaagaagcccagctcaggaaggaggtngctgccctgcgtgtgcagctggagcag
gcccgcagccacgggccgagcgggaaggaggaggctctgtgccggctgcaggaggagaac
cggcggctgagccaggagcaggagcggctggtggaagagctggaacgggagctgcagagt
aagcagcggctggagggcgagcggcaggagtcagaaagcaactgggaggcccagctcgcc
gacatcctcagctgggtgaatgatgagaaggtctccagaggctacctacaggccctggcc
accaagatggccgaggagctggagtccctgcggaatgtgggcacccagacgctccccacc
cggccactggaccaccagtggaaggcacggcggctgcagaagatggaggcctcggccagg
ctggaactgcagtcggcactggaggccgagatccgggccaagcagagcctgcaggagcgg
ctgacgcaggcgcaggaggcccagctgcaggccgagagccgtctgcaggaggccgagaag
cagaaccagagcctgaagcaggagctggctgcacttcgggaggagctgcgagcccgcggg
ccaggagacaccaagccctcaaactcgctgattcccttcctgtccttccggagttcagag
aaggatcccgccaaggaccctggcatctcaggagaggccccgaggccggggtcggaaccg
gagctgaggccggagggccgccgcagcctgcgcctgggggctgtgttccccagagcacct
gctgccaccacagctgctacagaaggccctcccgcaaagcctggctcccacacgctgcgc
ccccggagcttcccgtcccccaccaagtgtctccgctgcgcctcgctgatggtgggcctg
ggccgccaaggcctgggctgtgatgcctgcggctacttctgtcactcaacttgtgcccca
caggccccaccctgccccgtgccccctgaccttctccacgtggccctgggagtgcacccc
gaaacgggcacgggcactgcctatgagggcttcctgtcggtgcctcgaccctcgggtgtc
cggcggggctggcagcgggtgttcgctgccctcagtgactcacgcctgctgctgtttgac
gccccggacccgcggctcagcccagccagcggggccctcctgcaggcactggatctgagg
gacccccagttctctgccacccctgtcctggcctctgatgtgatccatgcccaatccaag
gacctgccacgcatctttagggtgacggcgtcccagctgacggtgccacctgccacgtgc
accgtgctgctgctggcggagagcgagggcgagcgggagcgctggctgcaggtgctgggc
gagctgcagcggctgctgctggacacgcggccacagccccggcctgtgtacacgctcaag
gaggcctacgacaatgggctgcccctgctgccgcacgcgctctgcgccgccatcatcgac
caggaacggcttgctctgggcactgaggaagggctgtttgtgatccacctgcacagcaac
gacatcttccaggtgggcgagtgccggcgggtgcagcggctggccgtgagccccactgcg
ggccttctggtcgtgctgtgcggccgtggccccagcgtgcgcctcttcgccctggctgag
ctggagagcacggaggtggcgggcgccaagatccccgagtctcgaggctgccaggtgctg
gcagccggacgcatcctgcaggcccgcacccccgtgctctgtgtggccgtcaagcgccag
gtgctgtgttaccagctgggtccgggcccagggccctggcagcaccgcatccgtgagctg
caggcaccggcccctgtgcagagcctcgggctgctgggcgaccggctgtgcgtgggtgcg
gcgggtgcctttgcgctctacccgctgctcaacgaggctgcacctttagctctgggggcc
gatctggtgcctgaggagctgccaccgtcccgtgggggcctgggcgaggctctgggcgct
gtggaactcagcctcaacgagttcctgctgctcttcaccaccgccggggtctacgtggac
ggtgccggccgcaagtctcgcatccatgagctgctgtggccagcagtgcccacgggctgg
ggttacgcagccccctacctgacagtgttcagtgagaactccatcgatgtgtttgacgtc
aggaaagcagagtgggtccagacggtgccactcaagaaggtgcgacccctgaacccagag
ggctccctgttcctctatggcaccgagaaggtccgcctgacctacctcaggaaccggctg
gcagagaaggacgagttcgacatccccgatctcaccgacaacagccggcgccagctgttc
cgtaccaagagcaagcgccgcttcttcttccgcgtgtcggaggagcagcggcagcagcag
cgcagggagatgctgaaggacccttttgtgcgctccaagctcatctcatcgcccaccaac
ttcaaccacctggtgcacatgggccctatggacgggaagcccagcgccaggaacccgccc
cgggctccggaagagaagggccgagggtcccgcagctccggcccgcagcggccccacagc
ttctcggaggcctcgcggcgcccagcgtccatgggcagcgacggccttgccggagacgcg
gaccccatgaagaggaagccttggacatctctctccagcgagtccgtgtcctgcccccag
ggatctctgagcccggcagcctccctgacacaggtctcagaacggccccggagcctcccg
cccgcccctgaaccagagagctccccttga

DBGET integrated database retrieval system