KEGG   Equus caballus (horse): 100056042Help
Entry
100056042         CDS       T01058                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1 isoform X1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100056042 (NCOA1)
   04919 Thyroid hormone signaling pathway
    100056042 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100056042 (NCOA1)
   05224 Breast cancer
    100056042 (NCOA1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100056042 (NCOA1)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100056042 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
15
AA seq 1455 aa AA seqDB search
MPDITKAGVKFFNMSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELA
ELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVI
EKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAE
FVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVS
QPKSIQEDGEDFQSCLICIARRLPRPPAVTGVESFMTKQDTTGKIISIDTSSLRAAGRTG
WEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLC
YPQSPDMQPFIMGIHIIDREHSGLSPQDDTSSGMSIPRVNPSVTPSISPAHGVARTSTLP
PSNSNMVSARVNRQQSSDLHSSSHSNSSNSQGNFGCSPGNPIVASVALNQGQANSQSTNP
SLNLSNSSMEGTGISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVGMTSTTCN
SSNRSYSNIPVTSLQSMNEGPNNSVGFSATSPVLRQMSSQNSPSRLNIQPAKTESKDNKE
IASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRH
ADIDTSCKEVLSCTGTSSSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSV
EPDKKDSASTSVSVTGQVQGNSSIKVELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLS
LDDVKVKVEKKEQMDPCNTNPTPMTKPAPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQL
PGLCETERMDGAVTSVPIKSEILPASLQSTTARPTTSRLNRLPELELEAIDNQFGQAGTG
DQIPWANNTVTTANQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDET
ELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLMMEERANIYSQPYSSPSPTANLSS
PFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQ
QLIHQNRQAILNQFAANTPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQL
IQQQRAMLMRQQSFGNNLPPSSGLPVQMGNTRLPQGAPQQFPYPPNYGTNPGTPPASTSP
FSQLAANPEATLANRNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFA
PSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAMGNNNVFSQAVQNQPTP
AQPGVYNNMSITVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGL
YCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQT
PQAQQKSLLQQLLTE
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatatcacaaaagcaggtgtgaagtttttcaacatgagtggccttggggacagt
tcatccgaccctgctaacccagactcacataagagaaaaggatcgccatgtgacacattg
gcatcaagcactgaaaagaggcgcagggagcaagaaaataaatacttagaagagctagct
gagttattgtctgccaacatcagtgacattgacagcttgagtgtaaaaccagacaaatgc
aagattttgaagaagacagtcgatcagatacagctaatgaagagaatggaacaagagaaa
tcaacaactgatgatgaagtgcagaagtcagacatctcatcaagtagtcaaggagtgata
gaaaaggaatccttgggacctcttcttttggaggctttggatggatttttctttgttgtg
aactgtgaagggagaattgtatttgtgtcagagaatgtgaccagctacttgggttacaat
caggaggaattaatgaataccagtgtctacagcatactgcacgtgggggatcatgcggag
tttgtgaagaatctgctaccaaaatcactcgtaaatggagttccttggcctcaagaggca
acacgacgaaatagccatacctttaactgcaggatgctaattcaccctccagatgaacca
ggcaccgagaaccaagaagcttgccagcggtatgaagtaatgcagtgtttcactgtgtca
cagccaaaatcaattcaagaggatggagaagatttccagtcgtgtttgatttgtattgca
cgacgattacctcggcctccagctgttacgggtgtggaatcctttatgaccaagcaagat
actacaggcaaaatcatctctattgataccagttccctgagagctgctggcagaactggc
tgggaagatttagtgaggaagtgcatttatgcttttttccaacctcagggcagagagcca
tcttacgccagacaactatttcaagaagtgatgactcgtggcactgcctccagcccatcc
tatagattcatattgaatgatgggacaatgcttagcgcccacaccaagtgtaaactttgc
taccctcaaagtccagacatgcaacctttcatcatgggaattcatatcatcgacagggaa
cacagtggtctttctcctcaagatgacactagttctggaatgtcaattccccgagtaaac
ccctccgtcactcctagtatctctccagctcatggtgtggcccgtacttccacattgcca
ccatccaacagcaacatggtatccgccagagtaaaccgccaacagagctcagaccttcat
agcagcagtcatagtaattctagcaacagtcaagggaattttggatgctcacctggaaat
ccaattgtagccagtgttgccttaaaccagggacaggccaattcccagagcactaatccc
tctttaaacctcagtaattcttctatggaaggtacaggaatatcccttgcacagttcatg
tctccaaggagacaagttagttctggattggcaacaaggcccaggatgccaaacaattca
tttcctcctaatattccaacattaagctcccccgttggcatgacaagtactacgtgtaat
agtagtaaccgatcttattcaaacatcccagtaacatctttacagagtatgaatgaagga
cccaataactctgttggcttctctgccacttctccagtcctccggcagatgagctcacag
aattcacccagcagattaaatatacaaccagcaaaaactgagtccaaagataacaaagag
attgcatccattttaaatgaaatgattcagtctgataacagctctagtgatggcaaacct
ctggattctgggcttctccataacaatgacagactctcagatggagacaataagtactct
caaaccagtcataaactagtgcagcttttgacaacaactgcagagcagcagttacggcat
gctgatatagacacaagttgcaaagaggtactgtcttgcacaggcacttccagctctgcc
tctgctaactcttcaagcggttcttgcccctcctctcatagctcactgacagagcggcac
aaaattttacaccggctcttacaggagggtagcccctcggatatcaccactttgtctgtg
gagcctgataaaaaggacagtgcatctacttctgtgtcagtgactggacaggtacaaggg
aactccagtataaaagtagaactggatgcttcaaagaaaaaagaatcaaaagaccatcag
cttctgcgctaccttttagataaagatgagaaagatttaagatcaactccaaacctgagc
ctggatgatgtaaaggtgaaagtggaaaagaaagaacagatggatccttgtaacacaaac
ccaaccccaatgaccaaacctgctcctgaggagataaaactggaggcccagagccagttt
acagctgaccttgaccagtttgatcagttactgcccacgctggagaaggcagcacagtta
ccaggcttatgtgagacagagaggatggatggtgcggtcaccagtgtacccatcaagtca
gagatcctgccagcttcacttcagtccaccactgccagacccaccacttcaaggctgaat
agattacctgagttggagttggaagcaattgataaccagtttggacaagcaggaacaggc
gatcagattccatgggcaaataatacagtgacaactgcaaatcaaaataaaccagaagac
cagtgtattagttcacaattagatgagcttctctgtccaccaacaacagtagaaggaaga
aatgatgagaaggctcttcttgaacagctggtgtcgttcctcagtggcaaagatgaaact
gagctagctgaactagatagagctctgggaattgacaaacttgttcagggaggtggatta
gatgtattatcagagagatttccaccacaacaagcaacaccacctttgatgatggaagaa
agagccaacatttactcccagccttattcttctccttcacctactgccaatctctctagc
cctttccaaggcatggtcaggcaaaaaccttccttggggactatgccagttcaagtaaca
cctccccgaggcgctttttcacctggcatgggcatgcagcccaggcaaacgctcaacaga
cctccagctgcacccaaccaacttcgacttcaacttcaacagcgattacagggacaacag
cagttgatacaccaaaatcggcaagctatcttgaaccagtttgcagcaaacactcctgtt
ggcatcaatatgagatcaggcatgcagcagcaaattacacctcagccacccctgaatgcc
caaatgttggcacagcgccagcgggagttgtacagtcaacagcaccgacaaaggcagcta
atacagcagcaaagagccatgctcatgaggcaacaaagctttgggaacaacctccctccc
tcatctggactgccagttcaaatggggaacacccgtcttcctcagggtgctccacagcaa
ttcccctacccaccaaactatggtacaaatccaggaaccccacctgcttctaccagccca
ttttcacaactggcagcaaatcctgaggcaaccttggccaaccgcaacagcatggtgaac
agaggcatgacgggaaatatgggaggacagtttggcactggaatcaatcctcagatgcag
cagaatgtcttccagtatccaggatcaggaatggttccccaaggtgaggccaactttgct
ccatctctaagccctgggagctccatggtgccgatgccaatccctcctcctcagagctct
ctgctccagcaaactccgccagcttctgggtaccagtcaccagacatgaaggcctggcag
caaggagcaatgggaaacaacaatgtgttcagtcaagctgtccagaaccagcctacgcct
gcacagccaggagtgtacaacaatatgagcatcaccgtgtccatggcaggtggaaacaca
aatgttcagaacatgaacccaatgatgggccagatgcaaatgagctctttgcagatgcca
ggaatgaacactgtgtgccctgagcagataaatgatccagcactgagacacacaggcctc
tactgcaaccagctctcatccactgaccttctcaaaacagaagcagatggaacccagcag
gtgcaacaggttcaggtgtttgctgacgtccagtgtacagtgaatctggtaggcggggac
ccttacctgaaccagcctggtccactgggaactcaaaaacccacatcaggaccacagacc
ccccaggcccagcagaagagcctccttcagcagctactgactgaataa

DBGET integrated database retrieval system