KEGG   Equus caballus (horse): 100056087Help
Entry
100056087         CDS       T01058                                 

Definition
cytochrome P450 2D14-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ecb00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ecb04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
28
AA seq 500 aa AA seqDB search
MGLLAGETLGLLAVAVAIFLLLVDLMHRRQRWAPRYPPGPMPLPGLGNLLQVDFQDPRCS
FTRLRDRFGDVFSLQLAWTPAVVINGLAAMREALVHRSEDTSDRPPVPIFEHLGFGPRSE
GLVMARYGQTWREQRRFSVSTLRNFGLGKKSLEQWVTQEASYLCAAFDDQAGRPFSPDAL
LNKAVSNVIASLTFGRRFDYNDPRFLRLLDLTEDLLKEETGFAPEVLNAIPMFLHIPGLP
AKVFPGHKAFMALLDELIAEHRKTRDLAQPPRDLTDAFLDEVEKAMGNPESSFNDENLRL
VLADLFPAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDEVIGQARRPEMGDQARMPFTM
AVVHEVQRFADIIPLGAPHMTSRDIEVQGFLIPKGTTLITNLSSVLKDETVWKKPFRFHP
EHFLDAQGRFVKQEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSD
HGVFGSMVTPAPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggactgctggccggggagacactggggctcctggctgtggccgtggccatcttcctg
ctcctggtggacctgatgcaccggcgccaacgctgggccccacgctaccccccaggcccc
atgcccctgcctgggctgggcaacctgctgcaggtggacttccaggatccacgctgcagc
tttactcggctgcgggaccgcttcggggacgtgttcagcctgcagctggcctggactccc
gcggtcgtgattaatgggctggcggccatgcgcgaggcgctggtgcaccgcagcgaagac
acctcggaccgtccgcctgtgcccatcttcgagcacctgggctttgggccgcgctcggaa
gggctggtcatggcgcgctatgggcagacgtggcgggagcagcggcgcttctccgtgtcc
accctgcgcaacttcggcctgggcaagaagtccctggagcagtgggtgacccaggaggcc
tcatacctctgtgccgccttcgatgaccaggccggacggcccttcagccctgacgccctc
ctgaataaagcggtgagcaacgtgatcgcctccctgaccttcgggcgccgcttcgactac
aacgacccgcgcttccttaggttattggaccttacagaggacttactgaaagaggagacc
ggcttcgcgccagaggtgttgaacgccatccccatgttcctgcacatcccggggctgcct
gccaaggtctttccagggcataaggccttcatggccctgctggatgagctgatcgctgag
cacaggaagacccgggacctggcacagcctccccgagacctcactgatgccttcctggat
gaggtggagaaggccatggggaaccctgagagcagcttcaatgatgagaatctgcgcctg
gtgttggccgacctgtttcctgcaggcatggtgaccacctccaccacgctggcctggggc
ctcctgctcatgatcctgcacccggatgtgcagcgccgtgtccaacaggagatcgatgag
gtgatagggcaggcgcggcgaccagagatgggggaccaggcccgcatgcccttcaccatg
gccgtggtccacgaggttcagcgctttgcggacatcatcccactgggtgcgccccacatg
acgtcccgtgacattgaagtgcagggcttcctcattcccaaggggaccacgctcatcacc
aacctgtcatcggtgctgaaggacgagaccgtctggaagaagcccttccgcttccacccc
gagcacttcctggacgcccagggccgcttcgtcaagcaggaggccttcatgcccttctca
gcaggccgccgctcgtgcctcggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctcggtgcccgctgggcagccccgccccagcgac
catggtgtctttggctccatggtaaccccggccccctaccagctctgtgctgtgccccgc
tag

DBGET integrated database retrieval system