KEGG   Equus caballus (horse): 100056161Help
Entry
100056161         CDS       T01058                                 

Gene name
KAT7, MYST2
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagtgatggcacatcccggcgatctgcc
cgagtcacccgctcctcagcccggctgagccagagttcccaagattccagccctgttcga
aatttgcagtcttttggcactgaggagcctgcttattctaccaggagagtgacccgtagt
cagcagcagcctaccccagtgactccgaaaaaatacccccttcggcagactcgttcatct
ggctcggaaactgaacaagtggttgacttttcagatagagaaactaaaaatacagctgat
catgatgagtctccacctcgaactccaactggaaatgcaccttcttctgagtctgacatt
gacatctccagccccaacgtgtctcatgatgagagcattgccaaagacatgtccttgaaa
gactcaggcagtgatctctctcatcgccccaagcgtcgtcgcttccatgaaagctacaat
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacac
gagagacatttctccatttcaggatgcccgctctatcataatctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggccccaacagagaggcagctgcgatat
aaggaaaaggtggctgaactcaggaagaaaaggaattctgggctgagcaaagaacagaaa
gaaaaatacatggaacacaggcagacctatgggaacactcgggaacctctcttggaaaac
ctgactagcgagtatgacttggatcttttccgaagagcacaagcccgggcatcagaggat
ttggagaagttgaggctgcaaggccaaatcacagaggggagcaatatgattaaaacaatt
gcttttggtcgctatgagcttgatacttggtaccattctccctatcctgaagaatatgca
cgactgggacgtctctacatgtgtgaattctgtttaaaatacatgaagagccaaacgata
ctccgccgacacatggctaaatgtgtgtggaaacacccacctggggatgagatatatcgc
aaaggctcaatctccgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaagctttttctggaccacaagacgttatattatgatgtggaaccc
ttcctgttctatgttatgacagaagcagacaacactggctgtcacctcattggatatttt
tccaaggaaaagaattcattcctcaactacaatgtatcctgcatccttaccatgcctcag
tacatgagacagggctatggcaagatgctcattgatttcagttatttgctttccaaagtg
gaagaaaaagttggctccccagaacgtccactctcagatctggggctcataagctatcgc
agttactggaaagaagtgcttctccgttacctgcataatttccaaggcaaagagatttct
atcaaagaaattagccaggagacagctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtattggaaaggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaagatccaactccaataaaaccatggatcca
agctgtttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system