KEGG   Equus caballus (horse): 100056161Help
Entry
100056161         CDS       T01058                                 

Gene name
KAT7
Definition
(RefSeq) histone acetyltransferase KAT7 isoform X1
  KO
K11307  histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100056161 (KAT7)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100056161 (KAT7)
   HAT complexes
    HBO1 complex
     100056161 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS zf-C2HC Acetyltransf_7 zf-met
Motif
Other DBs
NCBI-GeneID: 100056161
NCBI-ProteinID: XP_001502556
Ensembl: ENSECAG00000010150
UniProt: F6SN79
Position
11
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagtgatggcacatcccggcgatctgcc
cgagtcacccgctcctcagcccggctgagccagagttcccaagattccagccctgttcga
aatttgcagtcttttggcactgaggagcctgcttattctaccaggagagtgacccgtagt
cagcagcagcctaccccagtgactccgaaaaaatacccccttcggcagactcgttcatct
ggctcggaaactgaacaagtggttgacttttcagatagagaaactaaaaatacagctgat
catgatgagtctccacctcgaactccaactggaaatgcaccttcttctgagtctgacatt
gacatctccagccccaacgtgtctcatgatgagagcattgccaaagacatgtccttgaaa
gactcaggcagtgatctctctcatcgccccaagcgtcgtcgcttccatgaaagctacaat
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacac
gagagacatttctccatttcaggatgcccgctctatcataatctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggccccaacagagaggcagctgcgatat
aaggaaaaggtggctgaactcaggaagaaaaggaattctgggctgagcaaagaacagaaa
gaaaaatacatggaacacaggcagacctatgggaacactcgggaacctctcttggaaaac
ctgactagcgagtatgacttggatcttttccgaagagcacaagcccgggcatcagaggat
ttggagaagttgaggctgcaaggccaaatcacagaggggagcaatatgattaaaacaatt
gcttttggtcgctatgagcttgatacttggtaccattctccctatcctgaagaatatgca
cgactgggacgtctctacatgtgtgaattctgtttaaaatacatgaagagccaaacgata
ctccgccgacacatggctaaatgtgtgtggaaacacccacctggggatgagatatatcgc
aaaggctcaatctccgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaagctttttctggaccacaagacgttatattatgatgtggaaccc
ttcctgttctatgttatgacagaagcagacaacactggctgtcacctcattggatatttt
tccaaggaaaagaattcattcctcaactacaatgtatcctgcatccttaccatgcctcag
tacatgagacagggctatggcaagatgctcattgatttcagttatttgctttccaaagtg
gaagaaaaagttggctccccagaacgtccactctcagatctggggctcataagctatcgc
agttactggaaagaagtgcttctccgttacctgcataatttccaaggcaaagagatttct
atcaaagaaattagccaggagacagctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtattggaaaggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaagatccaactccaataaaaccatggatcca
agctgtttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system