KEGG   Equus caballus (horse): 100056163Help
Entry
100056163         CDS       T01058                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
ecb  Equus caballus (horse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ecb04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ecb04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ecb05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 129 aa AA seqDB search
MSHLHNLLLDTLLGTKHVDSAALIKIQERSLTVASPGFSVMPCDVRTLVNGFAKNPLQAR
REGLYFREKDYKCVRADDHSLYAKNENTGVVVVKTHVYLLVATYIEGMYPSVCVEATEKL
GEYLRKKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcacaacttactgttagataccctcctgggaacgaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcctgactgtagcatcaccaggatttagtgta
atgccctgtgatgtccgaacacttgtgaatggattcgccaagaaccccttgcaagccaga
agagaagggttgtatttcagggaaaaagactacaaatgtgtccgggcagatgaccattct
ctttatgctaagaatgaaaacactggtgtggtggttgtgaagactcatgtgtatcttctg
gtggcaacatacattgagggcatgtatcctagtgtttgtgtggaagccacagagaagctg
ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system