KEGG   Equus caballus (horse): 100056163Help
Entry
100056163         CDS       T01058                                 

Gene name
PFN4
Definition
(RefSeq) profilin-4 isoform X1
  KO
K05759  profilin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100056163 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100056163 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100056163 (PFN4)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100056163 (PFN4)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100056163 (PFN4)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100056163 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100056163
NCBI-ProteinID: XP_001503221
Ensembl: ENSECAG00000014609
UniProt: F7DPL3
Position
15
AA seq 129 aa AA seqDB search
MSHLHNLLLDTLLGTKHVDSAALIKIQERSLTVASPGFSVMPCDVRTLVNGFAKNPLQAR
REGLYFREKDYKCVRADDHSLYAKNENTGVVVVKTHVYLLVATYIEGMYPSVCVEATEKL
GEYLRKKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcacaacttactgttagataccctcctgggaacgaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcctgactgtagcatcaccaggatttagtgta
atgccctgtgatgtccgaacacttgtgaatggattcgccaagaaccccttgcaagccaga
agagaagggttgtatttcagggaaaaagactacaaatgtgtccgggcagatgaccattct
ctttatgctaagaatgaaaacactggtgtggtggttgtgaagactcatgtgtatcttctg
gtggcaacatacattgagggcatgtatcctagtgtttgtgtggaagccacagagaagctg
ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system