KEGG   Equus caballus (horse): 100056198Help
Entry
100056198         CDS       T01058                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100056198 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100056198 (PDIA3)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100056198 (PDIA3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100056198 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100056198 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100056198 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 624 aa AA seqDB search
MCPFPSVDLNTPSGSSSFSQFPPLPHLSPGSLPAHSALTSLLRPRLWRPLCPALLSQGEL
RVGSRARCGTFPAPPRRTPGPACAQTPQAEPCVVARPGFPQSPPKPRPFLAAPASPRRHA
TFRRLALLPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCK
RLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTA
DGIVSHLKKQAGPASVPLKTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDN
YRFAHTNVESLVNKYDDNGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIF
GICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLNFAV
ASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNL
KRYLKSEPIPESNDGPVKVVVAENFDEIVNDEKKDVLIEFYAPWCGHCKNLEPKYKELGE
KLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQ
REATNPPIIQEEKPKKKKKAQEDL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccttcccgagcgtcgacctcaacactccctcgggttccagctccttctctcaa
ttcccgcccctgcctcacctcagcccaggctcgcttcccgcccactcagccctgacttca
ctcctccgcccccggctctggcgccccctgtgtccggctctcctctcgcagggcgagctc
agggtcggctctcgggcgcgctgcggcacatttccagctccgccccgccgcaccccaggt
ccggcttgtgcccagacgccgcaggcagaaccgtgcgtggtcgcccgccccggcttcccg
cagtccccgccgaagccccgacccttcctggccgcccccgcctcacctcgccgccatgcc
accttccgccgcctagcgctgctcccgggcgtggcgctgctcctcgccgccgcccgcctc
gccgctgcctccgacgtgctggaactcacggacgacaacttcgagagtcgcatctctgac
acgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgcaag
aggcttgcccctgagtatgaagctgcagctaccagattaaaaggaatagtcccattagca
aaggttgattgtactgccaacacaaacacctgtaataagtatggagttagtggatatcca
accctaaagatatttagagatggtgaagaagcaggtgcttatgatgggcccaggactgcc
gatggaattgtcagccacctgaaaaagcaggcaggaccagcttcagttcctctcaagact
gaggaagaatttgagaagttcattagtgataaagatgcttctgtagtgggttttttcaag
gatttattcagtgaagctcactctgagtttctaaaagcagccagcaatttgagagataac
taccgatttgcacacaccaatgttgagtctctggtgaacaagtatgatgataatggagag
ggtatcactttgtttcgtccttcacatctgacgaacaagtttgaagacaagactgtggca
tatacagaacagaaaatgaccagtggcaagattaaaaaatttatccaggaaaacattttt
ggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggatttactt
atagcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggagaaac
agagtgatgatggtggcaaagaagttcctggatgctggaaacaaactcaactttgctgta
gctagccgcaaaacctttagtcacgaactttctgattttggcttggaaagcaccgctgga
gagattcctgttgttgccatcagaactgcaaaaggagagaagtttgtcatgcaggaggag
ttctcgcgtgatggtaaggctcttgagagattcctgcaggattattttgatggcaacctg
aagagatatctgaagtctgagcccatcccagagagcaatgacgggcccgtaaaggtagtg
gtggcagagaattttgatgaaatagtaaatgatgaaaagaaagatgtgctgattgaattt
tatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactgggagag
aagcttagaaaagacccaaatattgtcatagccaagatggatgccacagccaatgatgtg
ccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaagaag
ctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctacctacag
cgagaggctacaaatccccctataattcaagaagaaaaacccaagaagaagaagaaggca
caggaggatctctaa

DBGET integrated database retrieval system