KEGG   Equus caballus (horse): 100056198Help
Entry
100056198         CDS       T01058                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100056198 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100056198 (PDIA3)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100056198 (PDIA3)
Chaperones and folding catalysts [BR:ecb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100056198 (PDIA3)
Membrane trafficking [BR:ecb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100056198 (PDIA3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100056198 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100056198 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100056198 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 100056198
NCBI-ProteinID: XP_023474461
Ensembl: ENSECAG00000020252
Position
1
AA seq 505 aa AA seqDB search
MHLRRLALLPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLKTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDNGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDEKKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcacctccgccgcctagcgctgctcccgggcgtggcgctgctcctcgccgccgcccgc
ctcgccgctgcctccgacgtgctggaactcacggacgacaacttcgagagtcgcatctct
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagaggcttgcccctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgtactgccaacacaaacacctgtaataagtatggagttagtggatat
ccaaccctaaagatatttagagatggtgaagaagcaggtgcttatgatgggcccaggact
gccgatggaattgtcagccacctgaaaaagcaggcaggaccagcttcagttcctctcaag
actgaggaagaatttgagaagttcattagtgataaagatgcttctgtagtgggttttttc
aaggatttattcagtgaagctcactctgagtttctaaaagcagccagcaatttgagagat
aactaccgatttgcacacaccaatgttgagtctctggtgaacaagtatgatgataatgga
gagggtatcactttgtttcgtccttcacatctgacgaacaagtttgaagacaagactgtg
gcatatacagaacagaaaatgaccagtggcaagattaaaaaatttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggattta
cttatagcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagagtgatgatggtggcaaagaagttcctggatgctggaaacaaactcaactttgct
gtagctagccgcaaaacctttagtcacgaactttctgattttggcttggaaagcaccgct
ggagagattcctgttgttgccatcagaactgcaaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatggtaaggctcttgagagattcctgcaggattattttgatggcaac
ctgaagagatatctgaagtctgagcccatcccagagagcaatgacgggcccgtaaaggta
gtggtggcagagaattttgatgaaatagtaaatgatgaaaagaaagatgtgctgattgaa
ttttatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactggga
gagaagcttagaaaagacccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctaccta
cagcgagaggctacaaatccccctataattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system