KEGG   Equus caballus (horse): 100056198Help
Entry
100056198         CDS       T01058                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ecb  Equus caballus (horse)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ecb04141]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:ecb04612]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 624 aa AA seqDB search
MCPFPSVDLNTPSGSSSFSQFPPLPHLSPGSLPAHSALTSLLRPRLWRPLCPALLSQGEL
RVGSRARCGTFPAPPRRTPGPACAQTPQAEPCVVARPGFPQSPPKPRPFLAAPASPRRHA
TFRRLALLPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCK
RLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTA
DGIVSHLKKQAGPASVPLKTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDN
YRFAHTNVESLVNKYDDNGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIF
GICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLNFAV
ASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNL
KRYLKSEPIPESNDGPVKVVVAENFDEIVNDEKKDVLIEFYAPWCGHCKNLEPKYKELGE
KLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQ
REATNPPIIQEEKPKKKKKAQEDL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccttcccgagcgtcgacctcaacactccctcgggttccagctccttctctcaa
ttcccgcccctgcctcacctcagcccaggctcgcttcccgcccactcagccctgacttca
ctcctccgcccccggctctggcgccccctgtgtccggctctcctctcgcagggcgagctc
agggtcggctctcgggcgcgctgcggcacatttccagctccgccccgccgcaccccaggt
ccggcttgtgcccagacgccgcaggcagaaccgtgcgtggtcgcccgccccggcttcccg
cagtccccgccgaagccccgacccttcctggccgcccccgcctcacctcgccgccatgcc
accttccgccgcctagcgctgctcccgggcgtggcgctgctcctcgccgccgcccgcctc
gccgctgcctccgacgtgctggaactcacggacgacaacttcgagagtcgcatctctgac
acgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgcaag
aggcttgcccctgagtatgaagctgcagctaccagattaaaaggaatagtcccattagca
aaggttgattgtactgccaacacaaacacctgtaataagtatggagttagtggatatcca
accctaaagatatttagagatggtgaagaagcaggtgcttatgatgggcccaggactgcc
gatggaattgtcagccacctgaaaaagcaggcaggaccagcttcagttcctctcaagact
gaggaagaatttgagaagttcattagtgataaagatgcttctgtagtgggttttttcaag
gatttattcagtgaagctcactctgagtttctaaaagcagccagcaatttgagagataac
taccgatttgcacacaccaatgttgagtctctggtgaacaagtatgatgataatggagag
ggtatcactttgtttcgtccttcacatctgacgaacaagtttgaagacaagactgtggca
tatacagaacagaaaatgaccagtggcaagattaaaaaatttatccaggaaaacattttt
ggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggatttactt
atagcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggagaaac
agagtgatgatggtggcaaagaagttcctggatgctggaaacaaactcaactttgctgta
gctagccgcaaaacctttagtcacgaactttctgattttggcttggaaagcaccgctgga
gagattcctgttgttgccatcagaactgcaaaaggagagaagtttgtcatgcaggaggag
ttctcgcgtgatggtaaggctcttgagagattcctgcaggattattttgatggcaacctg
aagagatatctgaagtctgagcccatcccagagagcaatgacgggcccgtaaaggtagtg
gtggcagagaattttgatgaaatagtaaatgatgaaaagaaagatgtgctgattgaattt
tatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactgggagag
aagcttagaaaagacccaaatattgtcatagccaagatggatgccacagccaatgatgtg
ccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaagaag
ctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctacctacag
cgagaggctacaaatccccctataattcaagaagaaaaacccaagaagaagaagaaggca
caggaggatctctaa

DBGET integrated database retrieval system