KEGG   Equus caballus (horse): 100056199Help
Entry
100056199         CDS       T01058                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
ecb  Equus caballus (horse)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100056199 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100056199 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1418 aa AA seqDB search
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLNFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPTNKDVSEADLRI
LRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATEITAKFTALYSLSQYH
RQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDT
EAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPV
VPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDPSDNYSEPIDTIFRQKGYP
DEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKA
KSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQELDD
KKMKKKTHKVKEDKKQKKKAKNIPPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEF
IEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNISLVSMEVTVNAVAGALKAFFADLPDP
LIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYIITHLNRVSQQNKINLM
TADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETGNTVAPP
PPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgccccccatcctatactatcagtgtagttggactc
tctgggactgaaaaagacaagggtaactgtggagttggaaagtcctgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaataatgatcactttttgtactggggtgacataacacaa
aatggtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcctctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcagctgggcttg
gagcaagactttgaacagaagcaaatgcctgaagggaagctcaacgtagatggattttta
ttgtgcattgacgtaagtcagggatgtaatagaaagtttgatgaccaacttaaatttgtg
aataacctttttgtccaactatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcattaccttagagaagttcaggcatttgcttcaaacaaaaag
aaccttcttgtagtggaaacatcagcacgatttaacgtcaacattgagacatgtttcact
gcactggtacaaatgttggataaaactcgtggcaaacctaaaattattccctatctggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacgttttca
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagaatatataaac
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaaattaatggaaaagagagcagattttcagttatgttttgtggtg
ctagagaaaacaccttgggatgaaactgaccatatagacaaaattaatgatagacggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacaacat
ctaatatcagagaagaggagggtagaaatgaaggaaaaattcaaaaagactttggaaaaa
attcagttcatttcacctgggcagccgtgggaggaagttatgtgctttgttatggaggat
gaagccttcaaatatattactgaggctgatagcaaagaagtgtatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaggaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacccagttcagataaaatgagtgaaattcataca
gttttgagcgaagaacctagatataaagctttacagaaacttgcacctgatagggaatct
cttctacttaagcatatagggtttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtactgacattaaagtggagcagttacttgccagtagccttttgcagttggat
catggccgcttacggttgtatcatgatagtaccaatatagataaagttaatcttttcatt
ttagggaaggatggccttgcccaagagctagcaaatgagataaggacacaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggccagttgatgccaag
tcgccttactttttaagtcagttgtggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcactgaattttattggtgaatttattggaaaaataagaact
gaagcttctcagatcagaaaagataaatatatggctaatcttccatttacattaattctg
gctaatcagagagattctattagtaagaatctaccaattctcaggcaccaagggcaacag
ttggcaaacaagttacaatgtccttttgtagatgtacctgctggtacatatcctcgtaaa
tttaatgaaacccagataaagcaagctctaagaggagtattagaatcagttaaacataat
ttagatgtggtgagcccagttcctaccaataaggatgtatcggaagctgacttgagaatt
cttcgagcatttctatcagaagttcaggacaccattcctgtacagcttgtggcagttact
gacagccaagcagatttttttgaaaatgaggccattaaggaattaatgactgaaggtgaa
cacattgcaactgagatcactgctaaatttacagcgttgtattctttatctcaatatcat
cggcaaactgaggtctttacactgtttttcagtgatgttctagagaaaaaaaatatgata
gaaaattcttatttatctgataatacaagagaatcaacccatcaaagcgaagatgttttt
ctaccatctcccagagactgttttccctataacaactaccctgattcagatgatgataca
gaagcgccacctccttatagtccaattggggatgatgtacagttgcttccaacacctagt
gaccgttccagatacagattagatttggaaggaaatgaatatcctattcatagtacccca
aactgtcatgaccatgaacgcaaccataaagtgcctccacctattaaacctaaaccagtt
gtacctaagacaaatgtgaaaaaactagatccaaaccttttaaaaacaattgaagctggt
ataggtaaaaatccaagaaaacagacttcccgggtgcctttggcacatcctgaagatatg
gatccttcagataactattcggaacccattgacacaatcttcagacagaagggctatcct
gatgagatatatgttgtcccagatgatagtcagaatcgcattattaaaattcgaaactca
tttgtaaataacacccaaggagatgaagaaaatggattttcagatagaacctcaaaaagt
catggagaacgaaggccttcaaaatacaaatataaatctaaaaccttgtttagtaaagcc
aagtcgtactatagaagaacacattcagatgcaagtgatgatgaggcttttaccacttct
aaaacaaaaagaaaaggaagacatcgaggaagtgaggaagatccactgctttctcctgtg
gaaacttggaaaggtggtattgataatcctgcaatcacttccgaccaggagttagatgat
aagaagatgaagaagaaaacccacaaagtaaaagaagataagaagcagaaaaagaaagcg
aagaacattcctccaccaacacgcagaaattgggaaagtaattactttgggatgcctctc
caggatctggttacagctgagaagcccataccactatttgttgaaaaatgtgtggaattt
attgaagatacaggattatgtactgaaggactctaccgtgttagtgggaacaaaactgat
caagacaatattcaaaaacagtttgatcaagatcataacatcagtctagtatcaatggaa
gtaacagtaaatgctgtggctggagcccttaaagctttctttgcagatcttccagaccct
ttaattccatattctcttcatccagagctgttggaagcagcaaaaatcccggataaaaca
gaacgtcttcacgcgttgaaagaaattgttaagaaatttcatcctgtaaactatgatgta
ttcagatatataataacgcatctaaacagggttagtcagcaaaataaaatcaacctcatg
acagcagacaacttatccatctgtttttggccaactttgatgagacctgattttgaaaat
cgagagtttctgtctaccacgaagatccatcaatctgttgttgaaacgttcattcagcag
tgtcagtttttcttttacaatggagaaattgtggaaactgggaacactgtggctcctccg
ccaccttccaatccaggacagttggtggaaccaatggtaccacttcagttaccaccacca
ttgcaacctcagctgatacaaccgcagttacagacggatcctcttggtattatataa

DBGET integrated database retrieval system