KEGG   Equus caballus (horse): 100056217Help
Entry
100056217         CDS       T01058                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
ecb  Equus caballus (horse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100056217 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100056217 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100056217 (ITGA8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100056217 (ITGA8)
  Cell communication
   04510 Focal adhesion
    100056217 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100056217 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100056217 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100056217 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 1062 aa AA seqDB search
MSAGARRGPRGSRAQPLAPLWCFSAALGMLWSPASQAFNLDVDKFTVYSGPEGSYFGYAV
DFHIPTARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSVQCKQIPFDNTNNRKIKV
NGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAREKQTEVAPASYDDSYLGYSVAAGEFTADSQQELVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVAVSDVNNDGMDDVLIGAPLFMEREFESNPKEVGQVY
LYLQVSALVFRDPQVLTGTEVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGKDQRGKVLI
YNGNKDGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEATTSVACFSLRVCASAAGQSISNTIGLTVE
VQLDSLKQKGAVKRTLFLANHQPHLVFPLVIKRQNSFQCRDFVVYLRDETEFRDKLSPIN
ISLNYSLDDSTFKDGLEVKPILDHYRENVVTEQAHILVDCGEDNMCIPDLKLSARPDKHQ
VIIGDENHLMLTINARNEGEGAYEAELFVIIPEEADYVGIERSHKGLRPLSCEYKMENVT
RMVVCDLGNPMVAGTNYSLGLRFTVPRLEKTNVSINFDLQIKSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIHNWEPEEEPRKEEGVGPLVEHIYELHNIGPSSISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAAPAEDTPELSAFLRNSTIPH
LVRKRDVPGPELHRQSPAKILNCTNIECLQISCAVGRLDGGESAVVKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYRDQPAKLPEGSMAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTNEKTPDA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggggcccgccgcggtccccggggcagccgggcgcagccgctcgcgcccctc
tggtgcttctccgccgcgctggggatgctgtggtcccccgcctcgcaggcgttcaacttg
gacgtggacaagttcacggtgtacagcggccccgagggcagctacttcggctacgcggtg
gacttccacatacctactgctcgcacagcgagcgtcttggtgggggcgcccaaggccaac
accagccagccagacatcgtggaaggaggagccgtctattactgtccttggccggccgag
gggtctgtgcagtgcaaacagataccgtttgacaacaccaacaacagaaagatcaaagtt
aatggaaccaaggaacctatcgagtttaaatcgaatcaatggtttggagccaccgtgaaa
gcacacaaagggaaggttgtggcctgtgctcctttgtatcactggagaactcttaaacca
acaccagaaaaggaccccgttggcacttgctatgtagccattcagaatttcagtgcgtat
gctgagtactctccttgtcggaacagcaatgctgatcctgaaggccagggttactgccaa
gcaggatttagtctggatttttataagaatggagatcttatagtaggaggacctggcagt
ttttattggcaaggtcaggtgatcactgccagtattgctgatatcattgccaattactca
ttcaaggatattctaaggaaattggctcgagaaaaacagacagaagtggctccagcctcc
tacgatgatagttaccttggatattcagttgctgctggcgagttcactgcagactctcag
caagaattggttgctggagttccaagaggagcgcagaattttggatatgtttcaatcatc
aactccacagatatgaccttcattcagaatttcactggtgaacagatggcatcttatttt
gggtatacggttgcagtatcagatgttaacaatgatggaatggatgacgtgttgattggg
gcacctctctttatggaacgcgaatttgagagcaaccctaaagaagtaggacaagtttac
ctgtatttgcaagtgagcgctctcgtcttcagagacccacaggtcctcacgggcactgag
gttttcgggagattcggtagtgctgtggcacatttaggagatctgaaccaagatggatac
aatgacattgccatcggtgcaccctttgcaggcaaggatcaaagaggcaaagtgctcatt
tacaacgggaacaaggatggcttaaacaccaagccttcccaaatcctgcaaggagtgtgg
gcctcacaggccgtcccttccggattcggctttactttaagaggagattcagacatcgac
aagaatgattacccagatttaattgtgggtgcgttcggaacaggaaaagtagctgtttac
agagcaagaccagttgtgactgtggatgcccagcttctgctgcacccgatgattatcaac
cttgaaaataaaacttgccagattccagaggctacgacatctgtggcctgcttttcttta
agagtatgtgcatctgcggcaggccagagcatttcaaacacaataggcctgactgttgag
gtgcaattagattccctgaaacaaaaaggagccgttaaacgcacgctcttccttgctaat
catcagccacatctcgtcttccctctcgtgataaagcggcagaactccttccaatgccgg
gattttgttgtctaccttcgagatgaaactgaattccgagacaaattatctccaatcaac
attagtttgaattacagtttggatgactctacctttaaagatggcctggaggtgaaacca
atattggaccactacagggaaaatgtcgtcacggaacaggctcacatcctggtggactgt
ggagaagacaacatgtgcattcctgacctgaagctgtcagctagaccagataaacatcag
gtaatcattggagatgaaaatcaccttatgctcacaatcaacgcaagaaatgaaggagaa
ggagcctatgaggctgaactctttgtgataataccagaagaggcagattatgttgggatc
gaacgcagccacaagggactgcgaccactgagctgcgagtataagatggaaaatgtaacc
cgaatggtggtgtgtgaccttgggaaccctatggtggctggaacaaattattctctgggc
ctccgattcacggttccacggcttgagaaaaccaacgttagcattaactttgatctccaa
atcaaaagttccaacaaggacaacccagatagcaattttgtgagcctgcaaatcaacatc
actgctgtagctcaagtagaaataagaggagtatcccaccccccacagattgttctgccc
attcataactgggaaccagaagaggaacctcgcaaagaggagggagttggaccgttggtg
gaacatatttatgagttgcataatattggaccaagcagcatcagtgacaccctgctagag
gtgggctggccattctctgcccgggatgaatttctcctctacatttttcacattcaaact
ctgggacctctgcgatgtcaaacaaatcctgatatcaacccacaggatataaagcccgct
gcccctgcggaggacacccccgagctgagcgcctttttgcgaaactccaccatccctcac
cttgtcagaaagagggacgtgcctgggcccgagctccacagacagagccccgcaaaaata
ctgaattgtacaaatatcgagtgcttgcaaatctcctgcgcagtgggacgactagacgga
ggggaaagtgccgttgtgaaggtcagatcacgcttatgggccaagacatttctccagagg
aaaaatgatccctattctcttgcatccctggtgtcctttgaagttaagaagatgccttat
agagatcagccagcaaaacttccagaaggaagcatggcaattaagacatcagttatttgg
gcaaccccaaatgtttccttctccatcccgttatgggtaataatactagcaatacttctt
ggattgttggttctggccattttgaccttagctttatggaagtgtggattctttgacaga
gcaagaccgccccaagatgatatgaatgacagagaacaactgacaaatgagaaaacccct
gatgcatga

DBGET integrated database retrieval system