KEGG   Equus caballus (horse): 100056244Help
Entry
100056244         CDS       T01058                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ecb  Equus caballus (horse)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ecb04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:ecb04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ecb04910]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ecb05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLREEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
SCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSCLTQSAPASPTNKGIHIHQAGGSPPTSSTSSSSLTNDVAKQPVSRD
LPPGRPGPTGPTGVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDAAGHKSFISATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRVIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcgcctcttctgggactccgggaggaagatgaggccgac
cttacagactggaacctgcctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagaccgtcagtgtt
gccttagttttgtgcttgaatgtcggtgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgcttagaatgctggatcgatcctctgtcaatgggtcctcagaaagctctggaa
accattggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagcctcgatccaactgtggatgaagtgaagaagctttgcacgtcgttacgccgaaac
gccaaggaggagcgggttctcttccactacaatggccacggggtgccccggcccacagtg
aatggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccgtcgatatttgtctacgactgctccaatgccggc
cttatcgtcaagtccttcaagcagtttgccctgcagagggagcaggagttggaggtcgct
gcgattaacccgaaccacccactggcgcagatgcctctgcccccgtcgatgaagaactgc
attcagctggcagcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccactcccatcaagatcgccctgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttaatagaaaagattcctggc
cggctgaatgacaggaggactcctttgggcgagctgaattggatcttcacagcgatcacg
gacaccattgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgttccgaaattttttgctggcagagaggatcatgaggtcatat
agctgcacccccgtcagcagcccgcgcctgccccccacgtacatgcacgcgatgtggcaa
gcctgggaccttgctgtcgacatttgtctctctcagctgccgacgatcatcgaggaaggc
actgcatttcggcacagtccgttctttgctgagcagctgaccgcattccaggtgtggctc
acaatgggcgtggagaacaggaacccacctgaacaacttcccattgttttacaggtgctg
ctgagccaagtgcaccggctgagagccctggatctgctgggaagatttctggacctgggg
ccctgggcggtgagcctggccttgtctgtgggcatcttcccctacgtgctgaagctgctc
cagagctcagccagggagctgcggcctctccttgttttcatatgggccaagattctcgcc
gtggacagttcatgtcaagctgacctggtgaaggacaacggtcacaaatatttcctttcg
gtcttggcagacccttacatgccagctgaacataggacaatgacggctttcattctcgct
gtgattgtcaacagctataacacaggccaggaagcctgcctccagggaaacttgatcgcc
atttgcctggagcagctcaacgacccccaccccttgctgcgccagtgggtggccatctgc
ctaggacggatctggcagaattttgactcggctaggtggtgtggggtgagggacagtgct
cacgagaaactctgcagcctcctctccgaccccattcctgaggtgcgctgcgcagcagtc
tttgccctcgggacgtttgtgggcaactctgcagagaggaccgaccactcgaccaccatc
gaccacaatgtggccatgatgctggcccagctgatcaacgacgggagtcccgtggtccgg
aaggaactggtggtggctctgagtcatcttgtagttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaagaggaaaagaactaccccttgccttccccagcaaccaca
gagggcgggagtttgaccccagtacgggacagcccctgcacacccaggctccgttccgtg
agttcctacggaaacattcgggcagtcaccactgctagaagcttgaacaaatctttgcag
aatctgagcttgactgaagaatccggcagctctgtggcgttctcccccggaaacctgagc
accagcagcagcgccagcagcaccctgggcagcccagagaatgaggagtacatcctctcc
ttcgagaccatcgacaagatgcgccgcgtcagctcctactcctccctcaactctctcata
ggagtttctttcaatagcgtttacactcaaatttggagagtgttactgcatctggctgca
gatccctatccagatgtttccgatttggctatgaaagttctcaacagcatcgcctacaag
gccacagtgaacgcccggcctcagcgcatcctcaccacgtcctgtctcactcagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggccggaggctccccgccaaca
tccagcacaagcagctccagcctgaccaacgacgtggccaagcagccggtcagccgagac
ctgcctccaggccggccaggccccaccggccccacaggcgtgcagtacacaccccactcc
caccagttcccccggacacggaagatgtttgacaaaggcccggaccagaccaccgacgat
ccggatgatgctgctggacacaaaagtttcatctcggccacgatgcagacgggattctgt
gactggagcgcccgatactttgcgcagcctgtcatgaagatcccagaagagcatgacctg
gagagtcaaatccgcaaggagcgggaatggcgatttctacgcaacacccgcgtcagaaag
caggcgcagcaggtcatccagaagggtatcacgagactggatgaccagatatttctgaac
aggaaccctggcgtcccctccgtggtcaagtttcacccctttacaccatgtgtggccgta
gctgacaaagacagcatctgtttttgggactgggagaaaggggagaagctggattatttc
cacaacggaaaccctcggtacacaagggtcaccgccatggagtatctgaacggccaggac
tgctcgcttctgctcacagctacagatgatggtgccatcagagtctggaagaacttcgct
gatttggagaagaatccagaaatggtgaccgcttggcaggggctctcggacatgctgcca
acaacccgaggagccgggatggtggtggactgggagcaggagactggccttctcatgagc
tcgggggacgtgcgggtcatccggatctgggacacggaccgggagatgaaggtgcaggac
atccccacaggtgctgacagctgcgtgacaagcctgtcttgcgactcccaccgttccctc
gtcgtggccggccttggcgacggctccgtccgtgtctacgacagaaggatggcactcagc
gagtgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcttacctccag
aagcaccccgagggccacatcatgagcgtgagcgtcaatggagacgtgcgcttcttcgat
ccacggatgccggagtctgtgaatgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcgtgtggctccatgaaccagttcaccgccatctac
aatgggaacggggagctgatcaacaacatcaagtactacgacggcttcatgggccagcgc
gtcggagccatcagctgcttggccttccacccacactggcctcacctggccgtggggagc
aacgactactacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system