KEGG   Equus caballus (horse): 100056244Help
Entry
100056244         CDS       T01058                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ecb  Equus caballus (horse)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100056244 (RPTOR)
   04152 AMPK signaling pathway
    100056244 (RPTOR)
   04150 mTOR signaling pathway
    100056244 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100056244 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100056244 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLREEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
SCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSCLTQSAPASPTNKGIHIHQAGGSPPTSSTSSSSLTNDVAKQPVSRD
LPPGRPGPTGPTGVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDAAGHKSFISATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRVIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcgcctcttctgggactccgggaggaagatgaggccgac
cttacagactggaacctgcctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagaccgtcagtgtt
gccttagttttgtgcttgaatgtcggtgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgcttagaatgctggatcgatcctctgtcaatgggtcctcagaaagctctggaa
accattggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagcctcgatccaactgtggatgaagtgaagaagctttgcacgtcgttacgccgaaac
gccaaggaggagcgggttctcttccactacaatggccacggggtgccccggcccacagtg
aatggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccgtcgatatttgtctacgactgctccaatgccggc
cttatcgtcaagtccttcaagcagtttgccctgcagagggagcaggagttggaggtcgct
gcgattaacccgaaccacccactggcgcagatgcctctgcccccgtcgatgaagaactgc
attcagctggcagcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccactcccatcaagatcgccctgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttaatagaaaagattcctggc
cggctgaatgacaggaggactcctttgggcgagctgaattggatcttcacagcgatcacg
gacaccattgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgttccgaaattttttgctggcagagaggatcatgaggtcatat
agctgcacccccgtcagcagcccgcgcctgccccccacgtacatgcacgcgatgtggcaa
gcctgggaccttgctgtcgacatttgtctctctcagctgccgacgatcatcgaggaaggc
actgcatttcggcacagtccgttctttgctgagcagctgaccgcattccaggtgtggctc
acaatgggcgtggagaacaggaacccacctgaacaacttcccattgttttacaggtgctg
ctgagccaagtgcaccggctgagagccctggatctgctgggaagatttctggacctgggg
ccctgggcggtgagcctggccttgtctgtgggcatcttcccctacgtgctgaagctgctc
cagagctcagccagggagctgcggcctctccttgttttcatatgggccaagattctcgcc
gtggacagttcatgtcaagctgacctggtgaaggacaacggtcacaaatatttcctttcg
gtcttggcagacccttacatgccagctgaacataggacaatgacggctttcattctcgct
gtgattgtcaacagctataacacaggccaggaagcctgcctccagggaaacttgatcgcc
atttgcctggagcagctcaacgacccccaccccttgctgcgccagtgggtggccatctgc
ctaggacggatctggcagaattttgactcggctaggtggtgtggggtgagggacagtgct
cacgagaaactctgcagcctcctctccgaccccattcctgaggtgcgctgcgcagcagtc
tttgccctcgggacgtttgtgggcaactctgcagagaggaccgaccactcgaccaccatc
gaccacaatgtggccatgatgctggcccagctgatcaacgacgggagtcccgtggtccgg
aaggaactggtggtggctctgagtcatcttgtagttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaagaggaaaagaactaccccttgccttccccagcaaccaca
gagggcgggagtttgaccccagtacgggacagcccctgcacacccaggctccgttccgtg
agttcctacggaaacattcgggcagtcaccactgctagaagcttgaacaaatctttgcag
aatctgagcttgactgaagaatccggcagctctgtggcgttctcccccggaaacctgagc
accagcagcagcgccagcagcaccctgggcagcccagagaatgaggagtacatcctctcc
ttcgagaccatcgacaagatgcgccgcgtcagctcctactcctccctcaactctctcata
ggagtttctttcaatagcgtttacactcaaatttggagagtgttactgcatctggctgca
gatccctatccagatgtttccgatttggctatgaaagttctcaacagcatcgcctacaag
gccacagtgaacgcccggcctcagcgcatcctcaccacgtcctgtctcactcagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggccggaggctccccgccaaca
tccagcacaagcagctccagcctgaccaacgacgtggccaagcagccggtcagccgagac
ctgcctccaggccggccaggccccaccggccccacaggcgtgcagtacacaccccactcc
caccagttcccccggacacggaagatgtttgacaaaggcccggaccagaccaccgacgat
ccggatgatgctgctggacacaaaagtttcatctcggccacgatgcagacgggattctgt
gactggagcgcccgatactttgcgcagcctgtcatgaagatcccagaagagcatgacctg
gagagtcaaatccgcaaggagcgggaatggcgatttctacgcaacacccgcgtcagaaag
caggcgcagcaggtcatccagaagggtatcacgagactggatgaccagatatttctgaac
aggaaccctggcgtcccctccgtggtcaagtttcacccctttacaccatgtgtggccgta
gctgacaaagacagcatctgtttttgggactgggagaaaggggagaagctggattatttc
cacaacggaaaccctcggtacacaagggtcaccgccatggagtatctgaacggccaggac
tgctcgcttctgctcacagctacagatgatggtgccatcagagtctggaagaacttcgct
gatttggagaagaatccagaaatggtgaccgcttggcaggggctctcggacatgctgcca
acaacccgaggagccgggatggtggtggactgggagcaggagactggccttctcatgagc
tcgggggacgtgcgggtcatccggatctgggacacggaccgggagatgaaggtgcaggac
atccccacaggtgctgacagctgcgtgacaagcctgtcttgcgactcccaccgttccctc
gtcgtggccggccttggcgacggctccgtccgtgtctacgacagaaggatggcactcagc
gagtgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcttacctccag
aagcaccccgagggccacatcatgagcgtgagcgtcaatggagacgtgcgcttcttcgat
ccacggatgccggagtctgtgaatgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcgtgtggctccatgaaccagttcaccgccatctac
aatgggaacggggagctgatcaacaacatcaagtactacgacggcttcatgggccagcgc
gtcggagccatcagctgcttggccttccacccacactggcctcacctggccgtggggagc
aacgactactacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system