KEGG   Equus caballus (horse): 100056244Help
Entry
100056244         CDS       T01058                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR isoform X10
  KO
K07204  regulatory associated protein of mTOR
Organism
ecb  Equus caballus (horse)
Pathway
ecb04136  Autophagy - other
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04714  Thermogenesis
ecb04910  Insulin signaling pathway
ecb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100056244 (RPTOR)
   04152 AMPK signaling pathway
    100056244 (RPTOR)
   04150 mTOR signaling pathway
    100056244 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100056244 (RPTOR)
   04136 Autophagy - other eukaryotes
    100056244 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100056244 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100056244 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100056244 (RPTOR)
  Environmental adaptation
   04714 Thermogenesis
    100056244 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100056244 (RPTOR)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100056244 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 HEAT_EZ Hyccin
Motif
Other DBs
NCBI-GeneID: 100056244
NCBI-ProteinID: XP_001489653
Ensembl: ENSECAG00000017757
UniProt: F6QCM0
Position
11
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLREEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
SCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSCLTQSAPASPTNKGIHIHQAGGSPPTSSTSSSSLTNDVAKQPVSRD
LPPGRPGPTGPTGVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDAAGHKSFISATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRVIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcgcctcttctgggactccgggaggaagatgaggccgac
cttacagactggaacctgcctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagaccgtcagtgtt
gccttagttttgtgcttgaatgtcggtgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgcttagaatgctggatcgatcctctgtcaatgggtcctcagaaagctctggaa
accattggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagcctcgatccaactgtggatgaagtgaagaagctttgcacgtcgttacgccgaaac
gccaaggaggagcgggttctcttccactacaatggccacggggtgccccggcccacagtg
aatggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccgtcgatatttgtctacgactgctccaatgccggc
cttatcgtcaagtccttcaagcagtttgccctgcagagggagcaggagttggaggtcgct
gcgattaacccgaaccacccactggcgcagatgcctctgcccccgtcgatgaagaactgc
attcagctggcagcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccactcccatcaagatcgccctgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttaatagaaaagattcctggc
cggctgaatgacaggaggactcctttgggcgagctgaattggatcttcacagcgatcacg
gacaccattgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgttccgaaattttttgctggcagagaggatcatgaggtcatat
agctgcacccccgtcagcagcccgcgcctgccccccacgtacatgcacgcgatgtggcaa
gcctgggaccttgctgtcgacatttgtctctctcagctgccgacgatcatcgaggaaggc
actgcatttcggcacagtccgttctttgctgagcagctgaccgcattccaggtgtggctc
acaatgggcgtggagaacaggaacccacctgaacaacttcccattgttttacaggtgctg
ctgagccaagtgcaccggctgagagccctggatctgctgggaagatttctggacctgggg
ccctgggcggtgagcctggccttgtctgtgggcatcttcccctacgtgctgaagctgctc
cagagctcagccagggagctgcggcctctccttgttttcatatgggccaagattctcgcc
gtggacagttcatgtcaagctgacctggtgaaggacaacggtcacaaatatttcctttcg
gtcttggcagacccttacatgccagctgaacataggacaatgacggctttcattctcgct
gtgattgtcaacagctataacacaggccaggaagcctgcctccagggaaacttgatcgcc
atttgcctggagcagctcaacgacccccaccccttgctgcgccagtgggtggccatctgc
ctaggacggatctggcagaattttgactcggctaggtggtgtggggtgagggacagtgct
cacgagaaactctgcagcctcctctccgaccccattcctgaggtgcgctgcgcagcagtc
tttgccctcgggacgtttgtgggcaactctgcagagaggaccgaccactcgaccaccatc
gaccacaatgtggccatgatgctggcccagctgatcaacgacgggagtcccgtggtccgg
aaggaactggtggtggctctgagtcatcttgtagttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaagaggaaaagaactaccccttgccttccccagcaaccaca
gagggcgggagtttgaccccagtacgggacagcccctgcacacccaggctccgttccgtg
agttcctacggaaacattcgggcagtcaccactgctagaagcttgaacaaatctttgcag
aatctgagcttgactgaagaatccggcagctctgtggcgttctcccccggaaacctgagc
accagcagcagcgccagcagcaccctgggcagcccagagaatgaggagtacatcctctcc
ttcgagaccatcgacaagatgcgccgcgtcagctcctactcctccctcaactctctcata
ggagtttctttcaatagcgtttacactcaaatttggagagtgttactgcatctggctgca
gatccctatccagatgtttccgatttggctatgaaagttctcaacagcatcgcctacaag
gccacagtgaacgcccggcctcagcgcatcctcaccacgtcctgtctcactcagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggccggaggctccccgccaaca
tccagcacaagcagctccagcctgaccaacgacgtggccaagcagccggtcagccgagac
ctgcctccaggccggccaggccccaccggccccacaggcgtgcagtacacaccccactcc
caccagttcccccggacacggaagatgtttgacaaaggcccggaccagaccaccgacgat
ccggatgatgctgctggacacaaaagtttcatctcggccacgatgcagacgggattctgt
gactggagcgcccgatactttgcgcagcctgtcatgaagatcccagaagagcatgacctg
gagagtcaaatccgcaaggagcgggaatggcgatttctacgcaacacccgcgtcagaaag
caggcgcagcaggtcatccagaagggtatcacgagactggatgaccagatatttctgaac
aggaaccctggcgtcccctccgtggtcaagtttcacccctttacaccatgtgtggccgta
gctgacaaagacagcatctgtttttgggactgggagaaaggggagaagctggattatttc
cacaacggaaaccctcggtacacaagggtcaccgccatggagtatctgaacggccaggac
tgctcgcttctgctcacagctacagatgatggtgccatcagagtctggaagaacttcgct
gatttggagaagaatccagaaatggtgaccgcttggcaggggctctcggacatgctgcca
acaacccgaggagccgggatggtggtggactgggagcaggagactggccttctcatgagc
tcgggggacgtgcgggtcatccggatctgggacacggaccgggagatgaaggtgcaggac
atccccacaggtgctgacagctgcgtgacaagcctgtcttgcgactcccaccgttccctc
gtcgtggccggccttggcgacggctccgtccgtgtctacgacagaaggatggcactcagc
gagtgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcttacctccag
aagcaccccgagggccacatcatgagcgtgagcgtcaatggagacgtgcgcttcttcgat
ccacggatgccggagtctgtgaatgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcgtgtggctccatgaaccagttcaccgccatctac
aatgggaacggggagctgatcaacaacatcaagtactacgacggcttcatgggccagcgc
gtcggagccatcagctgcttggccttccacccacactggcctcacctggccgtggggagc
aacgactactacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system