KEGG   Equus caballus (horse): 100056278Help
Entry
100056278         CDS       T01058                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04015  Rap1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04714  Thermogenesis
ecb04722  Neurotrophin signaling pathway
ecb04723  Retrograde endocannabinoid signaling
ecb04728  Dopaminergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04912  GnRH signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04917  Prolactin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05014  Amyotrophic lateral sclerosis (ALS)
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05140  Leishmaniasis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05164  Influenza A
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05205  Proteoglycans in cancer
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100056278 (MAPK11)
   04010 MAPK signaling pathway
    100056278 (MAPK11)
   04370 VEGF signaling pathway
    100056278 (MAPK11)
   04668 TNF signaling pathway
    100056278 (MAPK11)
   04068 FoxO signaling pathway
    100056278 (MAPK11)
   04071 Sphingolipid signaling pathway
    100056278 (MAPK11)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100056278 (MAPK11)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100056278 (MAPK11)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100056278 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100056278 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100056278 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100056278 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    100056278 (MAPK11)
   04660 T cell receptor signaling pathway
    100056278 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    100056278 (MAPK11)
   04659 Th17 cell differentiation
    100056278 (MAPK11)
   04657 IL-17 signaling pathway
    100056278 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100056278 (MAPK11)
   04670 Leukocyte transendothelial migration
    100056278 (MAPK11)
  Endocrine system
   04912 GnRH signaling pathway
    100056278 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100056278 (MAPK11)
   04917 Prolactin signaling pathway
    100056278 (MAPK11)
   04926 Relaxin signaling pathway
    100056278 (MAPK11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100056278 (MAPK11)
  Nervous system
   04728 Dopaminergic synapse
    100056278 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100056278 (MAPK11)
   04722 Neurotrophin signaling pathway
    100056278 (MAPK11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100056278 (MAPK11)
  Development
   04380 Osteoclast differentiation
    100056278 (MAPK11)
  Environmental adaptation
   04714 Thermogenesis
    100056278 (MAPK11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100056278 (MAPK11)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100056278 (MAPK11)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100056278 (MAPK11)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100056278 (MAPK11)
  Infectious diseases
   05132 Salmonella infection
    100056278 (MAPK11)
   05133 Pertussis
    100056278 (MAPK11)
   05152 Tuberculosis
    100056278 (MAPK11)
   05164 Influenza A
    100056278 (MAPK11)
   05160 Hepatitis C
    100056278 (MAPK11)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100056278 (MAPK11)
   05169 Epstein-Barr virus infection
    100056278 (MAPK11)
   05145 Toxoplasmosis
    100056278 (MAPK11)
   05140 Leishmaniasis
    100056278 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    100056278 (MAPK11)
  Drug resistance
   01522 Endocrine resistance
    100056278 (MAPK11)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100056278 (MAPK11)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100056278 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100056278
NCBI-ProteinID: XP_001490139
Ensembl: ENSECAG00000004780
UniProt: F7A9Z3
Position
28
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLVHARRTYRELRLLKHLKHENVIGLLDVFTPATSIDDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLIYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFEPPEPPQPPSSL
ETGQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcccgcgcgccggcttctaccggcaggagctgaacaagacggtgtgggaggtg
ccgcagcggctgcaggggcttcgcccggtgggctccggcgcctacggctccgtctgctcg
gcctacgacgcgcggctgcgccagaaggtggcagtgaagaagctgtcgcggcccttccag
tctctggtccacgcgcggaggacttaccgcgagctgcggctgctcaaacacctgaagcac
gagaacgtcatcgggctgctggacgtcttcacgccagccacttccatcgatgacttcagc
gaagtgtacctggtcaccaccctgatgggcgccgacctgaacaacatcgttaagtgccag
gcgctgagcgacgagcacgtccagttcctcatctaccagctgcttcgagggctgaagtac
atccactccgctgggatcatccaccgggacctgaagcccagcaatgtggcggtgaatgag
gactgcgagcttaggatcctggactttgggctagcacgccaggctgacgaggagatgacc
ggctacgtggccactcgctggtaccgcgcacctgagatcatgctcaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggccgagctgctccagggaaag
gccctcttcccaggaaatgactacatcgaccagctgaagcgcatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcctcagaacatgcccggacatacatccag
tccctgccccccatgccccagaaggacctcaggagcatcttccacggagccaaccctctg
gctgtggacctcctgggaaggatgctggtgctggacagtgaccagagggtcagtgcagcc
gaggccctggcccatgcctatttcagccagtaccacgacccggacgacgagcctgaggcc
gagccctatgacgaaagcgttgaggccaaggagcgcacagtggaggagtggaaggagctc
acctaccaggaagtcctgagcttcgagcccccagagccaccgcagccacccagcagtctg
gagactgggcagtga

DBGET integrated database retrieval system