KEGG   Equus caballus (horse): 100056401Help
Entry
100056401         CDS       T01058                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ecb  Equus caballus (horse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100056401 (UROS)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100056401 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 264 aa AA seqDB search
MKVLLLKDPKEDDRGQDPYIRELGLYGFEATLIPVLSFEFLSLPSFSEKLSHPEGYGGLI
FTSPRAVEAVELCLEKDNKTEVWEKSLREKWNAKSVYVVGNATASLVNKIGLDTEGENCG
NAEKLAEYICSRESSALPLLFPCGTLKGEILPKMLKDKGIPMESITVYQKIPHPGIQANL
NSYYSQQGVPASITFFSPSGLTHSLKHIQELSGDSIDQIKFAAIGPTTARALAAQGLPVS
CTAESPTPSALAAGIRTALQPHSC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactgaaggaccctaaggaggacgaccgtggccaggacccgtacatc
agggaattaggattatatggatttgaagccactttgatccctgttttatcatttgagttt
ttgtctcttcccagtttctcagagaagctgtctcatccggaaggctatgggggactcatt
tttaccagcccccgagcagtggaagcagtggagctgtgtttagagaaagacaataaaact
gaagtctgggaaaagtctctgagagagaaatggaacgctaagtccgtgtatgtcgttgga
aatgctactgcttctctagtgaataaaattggcctggatacagaaggagaaaactgtgga
aatgcagaaaagcttgcagaatatatttgttccagggagtcatcagcactgcctcttctc
tttccctgtggaaccctcaaaggagagatcctgccgaaaatgctcaaggacaaagggatt
cccatggaaagcataactgtctatcagaagattccacacccgggaatccaagcgaacctg
aacagctactattcccagcagggcgttccagccagcatcacatttttcagtccctctggc
cttacgcacagtctcaagcatattcaagagttatctggtgacagcattgatcaaattaag
tttgcagccatcggccccaccacagctcgcgccctggccgcccagggcctgcctgtgagc
tgcactgcagagagccccacgccgagcgcgctggccgctggcatcaggacggcgctgcag
ccccacagctgctga

DBGET integrated database retrieval system