KEGG   Equus caballus (horse): 100056882Help
Entry
100056882         CDS       T01058                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
ecb  Equus caballus (horse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100056882 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100056882 (CYSLTR2)
G protein-coupled receptors [BR:ecb04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100056882 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 365 aa AA seqDB search
MSSSTLLASVTIKCWWPLRSMERKLMSSVPSVSSSETEPNGTFSSNDSHRNCTIENFKRE
FYPIIYLIIFVWGALGNGFSIYVFLQPYKKCTSVNVFMLNLAISDLLFTSTLPFRADYYL
RGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRSAWILC
GIIWIFIMASSAVLLKNGSEQDGNVTLCLELNLNKVIKLQALNYLALVVGFLLPFCTLSI
CYLLIIRALLMVKVSETGLRVSHRKALTTIIISLVIFLLCFLPYHVLRTLHLVMWEVGTC
IDWLHKAVVITLALAATNSCFNPLLYYFAGENFKDRLRSAVRKCHLQKIKCSFPVCVWLK
KETRV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatcgactcttctggcttcagttaccatcaagtgctggtggcccctacgttct
atggaaagaaaacttatgtcctcagttccatctgtctcctcatcagaaacagaacccaat
ggcaccttcagcagtaatgacagccacaggaactgcacaattgaaaacttcaagagagaa
ttttaccccatcatatacctgataatatttgtctggggagccttgggaaatggcttttcc
atatatgttttcctgcagccttataagaaatgcacatctgtgaatgttttcatgctaaac
ctggccatttcagatctcttgttcacaagcacactgcctttcagggctgactattacctc
agaggctccaattggatatttggggacctggcctgcagaattatgtcttattccctatat
gtcaacatgtacagcagcatctatttcctgactgtgctgagtgttgtgcgtttcctggca
actgttcaccccttccggctcctccatgtcaccagcatcagaagtgcctggattctatgt
gggatcatatggatctttattatggcttcgtcagcagtacttctgaagaatggctctgag
caagacggtaatgtcacattatgcttagagctgaatctgaataaagtcattaaactacag
gccttgaactacctcgccttggtggtgggcttcctgctgccattctgcacactcagcatc
tgttacctgctgatcattcgagccctgttaatggtgaaagtctcagaaacagggctgcgg
gtttctcacaggaaggcactaaccactatcatcatttccttagtcatctttctcctgtgc
ttcctgccctatcacgtactgagaaccctccacctggtcatgtgggaggtgggtacatgc
atagactggctacataaagctgtggtcatcacactggccttagcagcaaccaacagctgc
ttcaaccctttgctctattactttgctggggaaaattttaaggacagactaaggtctgca
gtcagaaaatgtcatctgcagaagataaagtgcagctttcctgtctgtgtatggttgaaa
aaggaaacaagagtgtaa

DBGET integrated database retrieval system