KEGG   Equus caballus (horse): 100056957Help
Entry
100056957         CDS       T01058                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
ecb  Equus caballus (horse)
Brite
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100056957 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 100056957
NCBI-ProteinID: XP_001503522
Ensembl: ENSECAG00000019751
UniProt: F7CLX6
Position
1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttactgcgggacgaagagctggaggagatcaagaaggag
actggcttttcccacagtcagatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaacgggaccctcagccgggaagatttccagcggattccagaacttgccatcaac
ccattgggggaccggatcatcaatgccttctttccggagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcatttccgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgacaagatttcccgcgatgagctgttacaggtgctacga
atgatggtcggagtgaatatctcagatgagcagctgggcagcattgcagacaggaccatc
caggaggctgatcaggatggggacagcgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system