KEGG   Equus caballus (horse): 100057047Help
Entry
100057047         CDS       T01058                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial isoform X1
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecb  Equus caballus (horse)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100057047 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100057047 (DLST)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100057047 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
24
AA seq 542 aa AA seqDB search
MARRPGSQRRRAPSVEPAPRKGREGPDRGVAGRSQAPSGEPARPAGSTASPTSAPQLPGR
RADGSAGSPAPPTARQWFVPNTPSPRGRVPGQPHFRLLPSPISGVRPPSAPLLPRCCPGP
AACPGRSAARSPPSRSINSSGVFSVRFFRTTAVCKDDVVTVKTPAFAESVTEGDVRWEKA
VGDTVAEDEVVCEIETDKTSVQVPAPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAK
AKPAEAPAAAAPEAEPPAAAVPPPPAASIPTQMPPAPSPSQPPASKPVSAVKPTPSPPVA
EPGAGKGVRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHRDAFL
KKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPV
IRNVEAMNYADIERIISELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQS
AILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
DL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgccctgggtcccagcggcgaagggcgccaagcgtagagccagctccgcgg
aaaggccgggaagggccggaccggggggtcgccggaaggtcgcaggcaccttcgggagag
ccggcgcggccagcaggcagcacagcaagccccacgagcgccccgcagctgccgggcagg
cgcgcggacggctcggcgggctcgccggctccccccacggcccgccagtggttcgttccg
aacaccccctccccgcgcggccgggttcccggccagccccacttccggttgctgccgagc
cctatatccggtgtccgcccgccctcggccccgctgctgccgcgatgctgtcccggtccc
gctgcgtgtcccgggcgttcagccgctcgctctccgccttccagaagcattaacagcagt
ggcgttttcagcgttcgcttcttcagaactacagctgtgtgcaaggatgatgtggttaca
gtcaaaaccccagcgttcgcagaatctgtcacagagggggacgtcaggtgggagaaagct
gttggagacacagttgcagaagatgaagtggtttgtgaaattgaaactgacaagacttct
gtgcaggttccagcaccagcaaatggcgtgattgaagctcttttggtacctgatggggga
aaagtagaaggaggcactcctcttttcacactcaggaaaactggcgctgctcctgccaag
gccaagccagccgaagctcctgctgctgcagccccagaagcagagcctcccgcagcagcg
gttcctcctccacctgcagcatccatacccactcagatgccgccagcgccctctccctca
cagcctcctgctagcaaaccagtgtctgcagtaaaaccaactccttcccctccagtagct
gagccaggagctggcaaaggtgtgcgttcagaacatcgggagaagatgaacaggatgcgg
cagcgcatcgctcagcggctgaaggaggcccagaatacatgtgcaatgctgaccactttc
aatgagattgacatgagtaacatccaggagatgagggctcggcacagagatgcttttctg
aagaaacataacctcaaactaggtttcatgtcggcgtttgtgaaggcctcagcctttgcc
ttgcaggagcagcctgttgtaaatgcagtgattgacgatgcaaccaaagaggtggtgtat
agggattatattgacatcagtgttgcagtggccaccccacggggtctggtggttcccgtc
atcaggaatgtagaagctatgaattacgccgacattgagcgaatcatcagtgaacttgga
gagaaggcccgaaagaatgaacttgccattgaagatatggatggtggtactttcaccatt
agcaatggaggcgtttttggctcgctctttggaacacccattatcaacccccctcagtct
gccatcctgggcatgcatggcatctttgataggccagtggccgtgggaggcaaggtggag
gtgcggcccatgatgtatgtggcactgacgtatgatcaccggctgatcgacggtagagag
gccgtgacttttctccgcaaaatcaaggcagcggtagaggatcccagagtcctcctactg
gacctctag

DBGET integrated database retrieval system