KEGG   Equus caballus (horse): 100057085Help
Entry
100057085         CDS       T01058                                 

Gene name
PYGB
Definition
phosphorylase, glycogen; brain
Orthology
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecb00500]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ecb04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 752 aa AA seqDB search
MGRTLQNTMVNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRLAACFLDSMATL
GLAAYGYGIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTP
EGVRWLDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLHDFNVGGYIEAVLDRN
LAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFP
DKVAIQLNDTHPALAIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVS
MFEKLLPRHLDIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGTH
AVNGVARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEG
FLTDLSQLKKLLPLASDEALIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRI
HEYKRQLLNCLHVVTLYNRIKKDPARPFVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVV
NHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIG
TMDGANVEMAEEAGAENLFIFGLRVEDVEALDQKGYHAREYYDRLPELRQAVDQISSGFF
SPKEPDCFKDVVNMLLNHDRFKVFADYEAYMACQAQVDQLYRNPKEWTKKVIKNIACSGK
FSSDRTITEYARDIWGVEPSDLQIPPPNLPKD
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcacgctgcagaacacaatggtgaacctgggccttcagaatgcttgtgacgaa
gccatctatcagttggggttggacttggaagaactcgaggaaatagaagaggatgccggc
cttgggaacggaggcttggggaggctggcagcctgcttccttgactcgatggccaccttg
ggcctggcagcatacggctatggaatccgctatgagtttggcatttttaaccagaagatt
gtcaatggctggcaggtggaggaggccgatgactggctgcgctacggcaacccctgggag
aaagcccggcccgagtacatgcttcctgtgcacttctatgggagagtggagcacaccccc
gagggcgtgaggtggctggacacacaggtggtgctggccatgccctacgacaccccagtg
ccgggctacaagaataacaccgttaacaccatgaggctgtggtccgccaaggcgcccaat
gacttcaagctccacgactttaacgtgggtggctacatcgaggcggtcctggacaggaac
ttggccgagaacatctctagagtcctgtatccgaatgacaacttctttgaggggaaggag
ctccgcctgaagcaggagtactttgtggtggctgccaccctccaggacatcattcgccgc
ttcaagtcctccaagttcggctgccgggatccagtgagaacttgtttcgagacgttccca
gacaaggttgccatccagctgaacgacacccacccggcccttgccatccccgagctcatg
cgcatcctggtggacgtggagaaagtggactgggacaaggcctgggaaatcacaaagaag
acctgtgcgtacaccaaccacactgtgctgccggaggccttggagcgctggcctgtgtcc
atgtttgagaagctgctgccgaggcacctggacatcatctatgccatcaaccagaggcac
ctggatcacgtggccgccctcttccctggcgatgtggaccgcctgcggaggatgtctgtc
atcgaggagggggactgcaagcggattaacatggcccacctgtgcgtgatcggcacccac
gctgtcaacggcgtggcaaggatccactcggagatcgtgaagcagtcagtctttaaggat
ttttacgagctagagccagagaagttccagaacaagacgaacggcatcacgccgcggcgg
tggctgctcctgtgcaacccaggcctggctgacaccatcgtggagaaaattggggagggt
ttcctgaccgacctgagccagctaaagaagctgctgccgttggccagtgacgaggcactc
atcagggatgtggccaaggtcaagcaggaaaacaagctcaagttctctgccttcctggag
aaggagtacaaggtgaagatcaacccctcctccatgttcgatgtgcatgtgaagaggatc
catgagtacaagcggcagctgctgaactgcctgcacgtggtcaccctgtacaaccgaata
aagaaggacccggccaggccctttgtgcccaggactgtcatgattgggggcaaggcagcc
cctggttaccacatggctaagatgatcatcaagctggtcacgtccatcggcgatgtcgtc
aaccatgatccagttgtgggcgacaggctcaaagtgatcttcctggagaactaccgtgtg
tccttggccgagaaagtgatccccgccgcagacctgtcgcagcagatctccacggcgggc
actgaggcctcaggcacgggcaacatgaagttcatgctcaacggggccctcaccatcggc
accatggacggggccaacgtggagatggctgaggaagccggggccgagaacctcttcatc
tttggcctgcgggtggaggacgttgaggctctggaccagaaagggtaccatgccagagag
tactacgaccgcctgcccgagctgaggcaggctgtggaccagatcagcagcggcttcttc
tcccccaaagagccagactgctttaaggatgttgtcaacatgctgttgaaccacgacagg
ttcaaagtgtttgcggattatgaagcatacatggcctgccaggcccaggtggaccagctc
taccggaaccccaaggagtggaccaagaaggtcatcaagaacattgcctgctcgggcaag
ttctccagcgaccggaccatcacggagtacgcgcgggacatctggggcgtggagccctct
gacctgcagatcccgccccccaatctccccaaggactag

DBGET integrated database retrieval system