KEGG   Equus caballus (horse): 100057085Help
Entry
100057085         CDS       T01058                                 

Gene name
PYGB
Definition
(RefSeq) phosphorylase, glycogen; brain
  KO
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100057085 (PYGB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100057085 (PYGB)
   04922 Glucagon signaling pathway
    100057085 (PYGB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100057085 (PYGB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     100057085 (PYGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 752 aa AA seqDB search
MGRTLQNTMVNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRLAACFLDSMATL
GLAAYGYGIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTP
EGVRWLDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLHDFNVGGYIEAVLDRN
LAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFP
DKVAIQLNDTHPALAIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVS
MFEKLLPRHLDIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGTH
AVNGVARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEG
FLTDLSQLKKLLPLASDEALIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRI
HEYKRQLLNCLHVVTLYNRIKKDPARPFVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVV
NHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIG
TMDGANVEMAEEAGAENLFIFGLRVEDVEALDQKGYHAREYYDRLPELRQAVDQISSGFF
SPKEPDCFKDVVNMLLNHDRFKVFADYEAYMACQAQVDQLYRNPKEWTKKVIKNIACSGK
FSSDRTITEYARDIWGVEPSDLQIPPPNLPKD
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcacgctgcagaacacaatggtgaacctgggccttcagaatgcttgtgacgaa
gccatctatcagttggggttggacttggaagaactcgaggaaatagaagaggatgccggc
cttgggaacggaggcttggggaggctggcagcctgcttccttgactcgatggccaccttg
ggcctggcagcatacggctatggaatccgctatgagtttggcatttttaaccagaagatt
gtcaatggctggcaggtggaggaggccgatgactggctgcgctacggcaacccctgggag
aaagcccggcccgagtacatgcttcctgtgcacttctatgggagagtggagcacaccccc
gagggcgtgaggtggctggacacacaggtggtgctggccatgccctacgacaccccagtg
ccgggctacaagaataacaccgttaacaccatgaggctgtggtccgccaaggcgcccaat
gacttcaagctccacgactttaacgtgggtggctacatcgaggcggtcctggacaggaac
ttggccgagaacatctctagagtcctgtatccgaatgacaacttctttgaggggaaggag
ctccgcctgaagcaggagtactttgtggtggctgccaccctccaggacatcattcgccgc
ttcaagtcctccaagttcggctgccgggatccagtgagaacttgtttcgagacgttccca
gacaaggttgccatccagctgaacgacacccacccggcccttgccatccccgagctcatg
cgcatcctggtggacgtggagaaagtggactgggacaaggcctgggaaatcacaaagaag
acctgtgcgtacaccaaccacactgtgctgccggaggccttggagcgctggcctgtgtcc
atgtttgagaagctgctgccgaggcacctggacatcatctatgccatcaaccagaggcac
ctggatcacgtggccgccctcttccctggcgatgtggaccgcctgcggaggatgtctgtc
atcgaggagggggactgcaagcggattaacatggcccacctgtgcgtgatcggcacccac
gctgtcaacggcgtggcaaggatccactcggagatcgtgaagcagtcagtctttaaggat
ttttacgagctagagccagagaagttccagaacaagacgaacggcatcacgccgcggcgg
tggctgctcctgtgcaacccaggcctggctgacaccatcgtggagaaaattggggagggt
ttcctgaccgacctgagccagctaaagaagctgctgccgttggccagtgacgaggcactc
atcagggatgtggccaaggtcaagcaggaaaacaagctcaagttctctgccttcctggag
aaggagtacaaggtgaagatcaacccctcctccatgttcgatgtgcatgtgaagaggatc
catgagtacaagcggcagctgctgaactgcctgcacgtggtcaccctgtacaaccgaata
aagaaggacccggccaggccctttgtgcccaggactgtcatgattgggggcaaggcagcc
cctggttaccacatggctaagatgatcatcaagctggtcacgtccatcggcgatgtcgtc
aaccatgatccagttgtgggcgacaggctcaaagtgatcttcctggagaactaccgtgtg
tccttggccgagaaagtgatccccgccgcagacctgtcgcagcagatctccacggcgggc
actgaggcctcaggcacgggcaacatgaagttcatgctcaacggggccctcaccatcggc
accatggacggggccaacgtggagatggctgaggaagccggggccgagaacctcttcatc
tttggcctgcgggtggaggacgttgaggctctggaccagaaagggtaccatgccagagag
tactacgaccgcctgcccgagctgaggcaggctgtggaccagatcagcagcggcttcttc
tcccccaaagagccagactgctttaaggatgttgtcaacatgctgttgaaccacgacagg
ttcaaagtgtttgcggattatgaagcatacatggcctgccaggcccaggtggaccagctc
taccggaaccccaaggagtggaccaagaaggtcatcaagaacattgcctgctcgggcaag
ttctccagcgaccggaccatcacggagtacgcgcgggacatctggggcgtggagccctct
gacctgcagatcccgccccccaatctccccaaggactag

DBGET integrated database retrieval system