KEGG   Equus caballus (horse): 100057168Help
Entry
100057168         CDS       T01058                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100057168 (ABHD12)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100057168 (ABHD12)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100057168 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
22
AA seq 500 aa AA seqDB search
MRKRLEPVALERERCAASGSSSSGAAAAALDADCRLKQNLRLAGKGPAEPRRAADAGMQR
ALGSVSDHSTMLRDELLRSQACCRALPQVGGLLWDLPVGLAPPTLSKLWSGWQGLCTCCK
CRGEARTPRNTSHEASLLRSFWLSDESLGIVGTLKLSTPGTLNIEGRKGLWFRLRKILLF
VLGLYFAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTI
GVWHTVPTVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGY
HVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRR
LCERETPPDALILESPFTNIREEAKSHPFSAIYRYFPGFDWFFLDPITSSGIKFANDENV
KHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSRSFRDFKVQFIPFHSDLGYRHKYIYKS
PELPRILREFLGRAERERQH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggctcgagcccgtcgccctggagcgggagcgctgcgccgcctcgggctcg
tcctcctccggcgcggccgccgcggcgctggacgccgactgccgcctgaagcagaatctg
cgcctggcgggcaaggggccggccgagccgcgccgcgccgccgacgcgggcatgcagcgg
gcgctgggcagtgttagtgatcacagcacaatgctgagggatgagcttctgaggtcacaa
gcctgctgcagagccttgcctcaggttggtggcctgctctgggacctccctgttggcctg
gcacctcccaccttgtcaaagctttggagtggctggcaaggtctgtgcacttgctgcaaa
tgccgtggggaagccaggacaccgaggaacacttcccatgaagccagtctcctccgctcc
ttctggctttctgatgaatcattgggaatcgtgggtaccctcaagttgtcaacaccaggg
actctgaacattgaagggcgaaagggcctgtggttccgactgaggaagatactgctcttt
gttttggggttgtactttgccattccgtttctcatcaaactgtgtcctgggatacaggcc
aaactgattttcttgaatttcgtgagggttccctatttcattgacttgaaaaaaccgcag
gatcaaggtttgaatcacacctgtaattactacctccagccagaggaagacgtgaccatt
ggagtctggcacactgtccccaccgtctggtggaagaatgcccaagggaaggaccagatg
tggtacgaggatgccttggcttccagccaccccatcatcctgtacctgcatgggaacgcg
ggcaccagaggaggcgaccaccgagtagagctctacaaggtgctgagttcccttggttac
cacgtggtcacctttgactacagaggttggggcgactcagtgggaacgccatcggagcgg
ggcatgacgtatgatgcactccatgtttttgactggatcaaagcaagaagtggagacaat
ccagtgtatatttggggtcattccctaggcactggagtggctacaaatctggtgcggcgc
ctctgtgagcgagagacgcctccggacgccctcatattggagtctcccttcaccaacatc
cgcgaagaagcaaagagccatccgttctcagcgatatatcgatacttccctgggtttgac
tggttcttccttgatcccattacaagcagtggaattaaatttgcaaatgatgaaaatgtg
aagcacatctcctgctccctgctcatcctgcacgctgaggacgacccggtcgtgcccttc
cagcttggcagaaagctctacaacattgctgcaccatctcgaagcttccgagacttcaaa
gttcagttcatcccctttcactcagacctcggctacaggcacaagtacatctacaagagc
cccgagcttccacggatactgagggagttccttgggagggcggaacgtgagcgtcagcac
tga

DBGET integrated database retrieval system